BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p08r (350 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33724| Best HMM Match : Ribosomal_L44 (HMM E-Value=0) 120 4e-28 SB_37591| Best HMM Match : Ribosomal_L44 (HMM E-Value=0.026) 62 9e-11 SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_57013| Best HMM Match : Pico_P2A (HMM E-Value=3.2) 25 1.8 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_52318| Best HMM Match : Pox_A32 (HMM E-Value=0.066) 27 3.2 SB_22849| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 27 3.2 SB_11815| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.002) 27 3.2 SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_48686| Best HMM Match : rve (HMM E-Value=1.2e-19) 27 3.2 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 27 4.3 SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) 27 4.3 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 27 5.7 SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_45117| Best HMM Match : Band_41 (HMM E-Value=7.4e-26) 27 5.7 SB_42699| Best HMM Match : SIR2 (HMM E-Value=1.6e-12) 27 5.7 SB_30079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_34643| Best HMM Match : GLTT (HMM E-Value=3.6) 27 5.7 SB_23678| Best HMM Match : Complex1_30kDa (HMM E-Value=6.8) 26 7.5 SB_46402| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_28235| Best HMM Match : rve (HMM E-Value=2.7e-11) 26 7.5 SB_12592| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.5 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 26 9.9 SB_20022| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.1e-20) 26 9.9 SB_15116| Best HMM Match : rve (HMM E-Value=5.8e-17) 26 9.9 SB_7514| Best HMM Match : OATP (HMM E-Value=0) 26 9.9 SB_6116| Best HMM Match : Patched (HMM E-Value=0.025) 26 9.9 SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) 26 9.9 SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) 26 9.9 SB_48542| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.1e-14) 26 9.9 SB_46125| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_24346| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.9 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 26 9.9 >SB_33724| Best HMM Match : Ribosomal_L44 (HMM E-Value=0) Length = 113 Score = 120 bits (288), Expect = 4e-28 Identities = 59/103 (57%), Positives = 69/103 (66%), Gaps = 2/103 (1%) Frame = -1 Query: 314 SKMVNVPKQRRTYXXXXX--XXXXXXVSQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIF 141 S +VNVPKQR+T+ V+QYK K AQG+RRYDRKQ G+GGQ+KP+F Sbjct: 6 SPVVNVPKQRKTFCKGKKCRRHTLHKVTQYKTGKASLFAQGKRRYDRKQSGFGGQTKPVF 65 Query: 140 XXXXXXXXKIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 12 KIVLR+EC CK R Q+ LKRCKHFELGGDKKRKG Sbjct: 66 HKKAKTTKKIVLRMECTQCKYRKQMPLKRCKHFELGGDKKRKG 108 >SB_37591| Best HMM Match : Ribosomal_L44 (HMM E-Value=0.026) Length = 39 Score = 62.5 bits (145), Expect = 9e-11 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 113 IVLRLECADCKVRSQVALKRCKHFELGGDKKRK 15 IVLR+EC CK R Q+ LKRCKHFELGGDKKRK Sbjct: 7 IVLRMECTQCKYRKQMPLKRCKHFELGGDKKRK 39 >SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1289 Score = 30.7 bits (66), Expect = 0.35 Identities = 22/80 (27%), Positives = 36/80 (45%) Frame = -2 Query: 325 AERTQKW*TYQNSAGRTAKNVNATKYTRYHSTKSPRKGTLPRVEDVMIVNSRVTVVSPNP 146 AE +W T + + +K + + K R T P + D+ +R+T VSP Sbjct: 1021 AESFHRWLTQRQFCAQYSKELASGKTNREWVTALPIV-----ISDINATKTRMTGVSPKD 1075 Query: 145 SSKRRQKPLRKLCSVLSVPI 86 + K R+ PL+ L VP+ Sbjct: 1076 AIKLRRVPLKAEKPPLEVPL 1095 >SB_57013| Best HMM Match : Pico_P2A (HMM E-Value=3.2) Length = 474 Score = 24.6 bits (51), Expect(2) = 1.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 77 RSQVALKRCKHFELGGD 27 +S++A RC H LGGD Sbjct: 419 QSRIAFPRCAHGPLGGD 435 Score = 22.2 bits (45), Expect(2) = 1.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 224 SKERHAAQGRRRYDRKQQGYGGQSKPIF 141 ++ RH + RRRY + G QS+ F Sbjct: 397 AERRHNGRDRRRYGQPDSGDVRQSRIAF 424 >SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1442 Score = 27.9 bits (59), Expect = 2.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 101 LECADCKVRSQVALKRCKHFELG 33 +EC +CK R +A C HF+ G Sbjct: 1113 IECPNCKFRYDLAKGGCMHFKCG 1135 >SB_52318| Best HMM Match : Pox_A32 (HMM E-Value=0.066) Length = 716 Score = 27.5 bits (58), Expect = 3.2 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 167 NPAVYDHNVFYPGQRAFPWTF-CTVIPCVLCGIYIFCSTSCA 289 +P + DH VFYP P TF T+ P + I ++ ST+ A Sbjct: 167 HPILNDHGVFYPKALPHPLTFEITLAP--VSDIVVYSSTTPA 206 >SB_22849| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1359 Score = 27.5 bits (58), Expect = 3.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +2 Query: 167 NPAVYDHNVFYPGQRAFPWTFCTVIPCVLCGIYIFCSTSCA 289 +P + DH VFYP P TF + + I ++ ST+ A Sbjct: 1172 HPILNDHGVFYPKALPHPLTF-EITLATVSDIVVYSSTTPA 1211 >SB_11815| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.002) Length = 1725 Score = 27.5 bits (58), Expect = 3.2 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 167 NPAVYDHNVFYPGQRAFPWTF-CTVIPCVLCGIYIFCSTSCA 289 +P + DH VFYP P TF T+ P + I ++ ST+ A Sbjct: 1243 HPILNDHGVFYPKALPHPLTFEITLAP--VSDIVVYSSTTQA 1282 >SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 27.5 bits (58), Expect = 3.2 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -2 Query: 199 VEDVMIVNSRVTVVSPNPSSKRRQKPLRKLCSVLSVPI 86 + D+ N+R+T +P + K R+ PL+ L VP+ Sbjct: 676 ISDINATNTRMTGFAPKDAKKLRRVPLKAEKPPLEVPL 713 >SB_48686| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 722 Score = 27.5 bits (58), Expect = 3.2 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -2 Query: 199 VEDVMIVNSRVTVVSPNPSSKRRQKPLRKLCSVLSVPI 86 + D+ N+R+T +P + K R+ PL+ L VP+ Sbjct: 624 ISDINATNTRMTGFAPKDAKKLRRVPLKAEKPPLEVPL 661 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 27.1 bits (57), Expect = 4.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 5 HLVPFSSCHHRAQSACISSMQPVISPCNR 91 HL P + C R S+++P++SPC R Sbjct: 800 HLDPNADCEDRCGPGS-SNLRPILSPCQR 827 >SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) Length = 1575 Score = 27.1 bits (57), Expect = 4.3 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -2 Query: 241 YHSTKSPRK-GTLPRVEDV--MIVNSRVTVVSPNPSSKRRQK 125 Y + P+K G RV+++ ++ R T+ PN S RRQ+ Sbjct: 1011 YEAAWDPKKSGNTERVQELQGVVTTDRQTIDDPNTSESRRQE 1052 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 26.6 bits (56), Expect = 5.7 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = -2 Query: 253 KYTRYHS-TKSPRKGTLPRVEDVMI--VNSRVTVVSPNPSSKRRQ 128 K TRY S T S R P ++ + +NS SP+PS+KR + Sbjct: 2061 KSTRYSSRTSSNRDSRTPPADEKIRADINSNEVQSSPSPSTKREE 2105 >SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +1 Query: 202 WAACLSLDFLYCDTLCTLWHLHFLQYVLRCFG 297 W L F+ C TLC W + Y R G Sbjct: 283 WIGAWWLGFVICGTLCIFWSIWLFGYPKRIPG 314 >SB_45117| Best HMM Match : Band_41 (HMM E-Value=7.4e-26) Length = 458 Score = 26.6 bits (56), Expect = 5.7 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -2 Query: 229 KSPRKGTLPRVEDVMIVNSRVTVVSPNPSSKRRQKPLRKLCSVLSVP 89 K PR+ L + + V++ NS T + ++ LR++C L++P Sbjct: 61 KMPRESGLFKCQVVLLDNSTFTTSFEKRKETKGKELLRRVCIELNIP 107 >SB_42699| Best HMM Match : SIR2 (HMM E-Value=1.6e-12) Length = 501 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 227 KSKERHAAQGRRRYDRKQQGY 165 K K+RHA Q YD+K Q Y Sbjct: 471 KQKDRHARQLGINYDKKHQNY 491 >SB_30079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 877 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 77 RSQVALKRCKHFELGGDKKR 18 +S++A RC H LGGD +R Sbjct: 495 QSRIASPRCAHRPLGGDSRR 514 >SB_34643| Best HMM Match : GLTT (HMM E-Value=3.6) Length = 399 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +2 Query: 191 VFYPGQRAFPWTFCTVIPCVLCGIYIFCSTSCAVLV 298 VFYP P V+ C+ + + C C +LV Sbjct: 105 VFYPPSNGLPVFTLLVMDCLCFTLLVMCYLCCTLLV 140 >SB_23678| Best HMM Match : Complex1_30kDa (HMM E-Value=6.8) Length = 207 Score = 26.2 bits (55), Expect = 7.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 199 VEDVMIVNSRVTVVSPNPSSKRRQKPLRKLCSVLSVPI 86 VED+ +R+T +P + K R+ PL+ L VP+ Sbjct: 53 VEDINATKTRMTGFAPKDAIKLRRVPLKAEKPPLMVPL 90 >SB_46402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 26.2 bits (55), Expect = 7.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 77 RSQVALKRCKHFELGGD 27 RS++A RC H LGGD Sbjct: 504 RSRIAFTRCAHGPLGGD 520 >SB_28235| Best HMM Match : rve (HMM E-Value=2.7e-11) Length = 188 Score = 26.2 bits (55), Expect = 7.5 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -2 Query: 211 TLPRV-EDVMIVNSRVTVVSPNPSSKRRQKPLRKLCSVLSVPI 86 TLP V D+ +R+T ++P + K R+ PL+ L VP+ Sbjct: 127 TLPIVISDINATKTRMTGLAPEDAIKLRRVPLKAERPPLEVPL 169 >SB_12592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 26.2 bits (55), Expect = 7.5 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = -2 Query: 301 TYQNSAGRTAKNVNATKYTRYHSTKSPR----KGTLPRVEDV--MIVNSRVTVVSPNPSS 140 T +S G + T +T K+ R G RV+++ ++ R T+ PN S Sbjct: 43 TSTSSRGARTQTTAETSFTTEGRCKAKRLQAVDGVTERVQELQGVVATDRETIDDPNTSE 102 Query: 139 KRRQK 125 RRQ+ Sbjct: 103 SRRQE 107 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 25.8 bits (54), Expect = 9.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 Query: 230 CTVIPCVLCGIYIFCSTSCAVLVRSPFLS 316 CTV PCVL G C+ +C VL P S Sbjct: 2123 CTVNPCVLNG---GCTHTCTVLDGKPVCS 2148 >SB_20022| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.1e-20) Length = 392 Score = 25.8 bits (54), Expect = 9.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 125 FLPSF*RWVWTDHRNPAVYDHN 190 + P +WVW +H NP +N Sbjct: 123 YKPKDQKWVWYEHENPVKMSNN 144 >SB_15116| Best HMM Match : rve (HMM E-Value=5.8e-17) Length = 317 Score = 25.8 bits (54), Expect = 9.9 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -2 Query: 232 TKSPRKGTLPRV-EDVMIVNSRVTVVSPNPSSKRRQKPLRKLCSVLSVPI 86 T S TLP V D+ +R+T ++P + K R+ PL+ L VP+ Sbjct: 203 TNSEWVTTLPIVISDMNATKTRMTGLAPEDAIKLRRVPLKAEKPPLEVPL 252 >SB_7514| Best HMM Match : OATP (HMM E-Value=0) Length = 763 Score = 25.8 bits (54), Expect = 9.9 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 Query: 202 WAACLSLDFLYCDTLCTLWHL 264 W L F+ C TLC W L Sbjct: 331 WVGAWWLGFVVCGTLCIFWSL 351 >SB_6116| Best HMM Match : Patched (HMM E-Value=0.025) Length = 831 Score = 25.8 bits (54), Expect = 9.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 295 QNSAGRTAKNVNATKYTRYH 236 +NS+GRT KN++AT H Sbjct: 141 KNSSGRTCKNISATHKLSLH 160 >SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) Length = 1606 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -2 Query: 199 VEDVMIVNSRVTVVSPNPSSKRRQKPLRKLCSVLSVPI 86 + D+ +RVT ++P + K R+ PL+ L VP+ Sbjct: 1186 ISDMNATKTRVTGLAPEDAIKLRRVPLKAKKPPLEVPL 1223 >SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) Length = 390 Score = 25.8 bits (54), Expect = 9.9 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = -2 Query: 277 TAKNVNATKYTRYHSTKSPRKGTLPRV-EDVMIVNSRVTVVSPNPSSKRRQKPLRKLCSV 101 T + V +K T TLP V D+ +R+T ++P + K R+ PL+ Sbjct: 158 TDRGVEYSKELASGKTNREWVTTLPIVISDMNATKTRMTGLAPEDAIKLRRVPLKAEKPP 217 Query: 100 LSVPI 86 L VP+ Sbjct: 218 LEVPL 222 >SB_48542| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.1e-14) Length = 594 Score = 25.8 bits (54), Expect = 9.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 131 PSF*RWVWTDHRNPA 175 P+ +WVW +H NPA Sbjct: 306 PARQKWVWYEHENPA 320 >SB_46125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1564 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = -2 Query: 208 LPRVEDVMIVNSRVT--VVSPNPSSKRRQKPLRKLCSVLS 95 + +VE++++ + +V V +P+P+ R P LC +LS Sbjct: 382 ISKVEELLVASCKVPEKVNAPSPAQTLRSLPRVSLCYILS 421 >SB_24346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 25.8 bits (54), Expect = 9.9 Identities = 20/80 (25%), Positives = 36/80 (45%) Frame = -2 Query: 325 AERTQKW*TYQNSAGRTAKNVNATKYTRYHSTKSPRKGTLPRVEDVMIVNSRVTVVSPNP 146 AE +W T + + +K++ + K R T P + D+ +R+T +P Sbjct: 37 AESFHRWLTQRLFRAQYSKDLASGKTNREWVTALPIV-----ISDINATKTRMTGFAPKH 91 Query: 145 SSKRRQKPLRKLCSVLSVPI 86 + K R+ PL+ L VP+ Sbjct: 92 AIKLRRVPLKAEKPPLEVPL 111 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 25.8 bits (54), Expect = 9.9 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -2 Query: 235 STKSPRKGTLPRVEDVMIVNSRVTVVSPNPSSKRRQKPLRKLCSVLSVP 89 + K P K T+P ED ++ +V + S ++ PLR + S SVP Sbjct: 191 NNKDPVK-TIPNKEDNASLSRTRSVYDNDSLSSDKKDPLRPMISYRSVP 238 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,933,344 Number of Sequences: 59808 Number of extensions: 228610 Number of successful extensions: 1017 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1016 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 535585339 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -