BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p08r (350 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB) 114 2e-26 At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA... 114 2e-26 At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) ... 27 2.7 At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containi... 27 2.7 At5g18530.1 68418.m02191 beige/BEACH domain-containing protein c... 27 3.5 At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revo... 26 6.1 At3g14250.1 68416.m01804 zinc finger protein-related contains we... 26 8.1 At2g47090.1 68415.m05882 zinc finger (C2H2 type) family protein ... 26 8.1 At1g59790.1 68414.m06732 cullin-related low similarity to Hs-CUL... 26 8.1 >At4g14320.1 68417.m02206 60S ribosomal protein L36a/L44 (RPL36aB) Length = 105 Score = 114 bits (274), Expect = 2e-26 Identities = 56/101 (55%), Positives = 66/101 (65%), Gaps = 2/101 (1%) Frame = -1 Query: 308 MVNVPKQRRTYXXXXXXXXXXXV--SQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIFXX 135 MVN+PK + TY +QYKK K+ AAQG+RRYDRKQ GYGGQ+KP+F Sbjct: 1 MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK 60 Query: 134 XXXXXXKIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 12 KIVLRL+C CK SQ +KRCKHFE+GGDKK KG Sbjct: 61 KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101 >At3g23390.1 68416.m02949 60S ribosomal protein L36a/L44 (RPL36aA) similar to ribosomal protein L41 GB:AAA34366 from [Candida maltosa] Length = 105 Score = 114 bits (274), Expect = 2e-26 Identities = 56/101 (55%), Positives = 66/101 (65%), Gaps = 2/101 (1%) Frame = -1 Query: 308 MVNVPKQRRTYXXXXXXXXXXXV--SQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIFXX 135 MVN+PK + TY +QYKK K+ AAQG+RRYDRKQ GYGGQ+KP+F Sbjct: 1 MVNIPKTKNTYCKNKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYGGQTKPVFHK 60 Query: 134 XXXXXXKIVLRLECADCKVRSQVALKRCKHFELGGDKKRKG 12 KIVLRL+C CK SQ +KRCKHFE+GGDKK KG Sbjct: 61 KAKTTKKIVLRLQCQSCKHFSQRPIKRCKHFEIGGDKKGKG 101 >At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) family protein low similarity to Translation initiation factor IF-3 from [subsp. Schizaphis graminum] {Buchnera aphidicola} SP|P46243, {Salmonella typhimurium} SP|P33321; contains Pfam profiles PF05198: Translation initiation factor IF-3 N-terminal domain, PF00707: Translation initiation factor IF-3 C-terminal domain Length = 520 Score = 27.5 bits (58), Expect = 2.7 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -2 Query: 274 AKNVNATKYTRYHSTKSPRKGTLPRVEDVMIVNSRVTVVSPNPSSKR 134 A A R+ P+KG + ++D+ I ++RV SP P S + Sbjct: 238 ADRKGAVVIVRHAKFGPPKKGGVKLMKDIDIKSARVKEESPKPDSSK 284 >At1g33400.1 68414.m04135 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 798 Score = 27.5 bits (58), Expect = 2.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 239 IPCVLCGIYIFCSTSCAV 292 +PC C I ++CS SC + Sbjct: 275 VPCPSCSIPVYCSESCQI 292 >At5g18530.1 68418.m02191 beige/BEACH domain-containing protein contains 5 WD-40 repeats (PF00400); contains Beige/BEACH domain (Pfam PF02138); FACTOR ASSOCIATED WITH N-SMASE ACTIVATION (FAN) (SP:Q92636) Homo sapiens;similar to Lipopolysaccharide-responsive and beige-like anchor protein (CDC4-like protein) (Beige-like protein) (SP:P50851) [Homo sapiens} Length = 909 Score = 27.1 bits (57), Expect = 3.5 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +2 Query: 173 AVYDHNVFYPG--QRAFPWTFCTVIPCVLCGIYIFCS--TSCAVLVRSPFLSS 319 +VY+ N YP QR + WT IP C IFCS S + L P+ SS Sbjct: 459 SVYEPNE-YPSDMQRLYDWTPDECIPEFYCDPRIFCSLHPSMSDLAVPPWASS 510 >At5g60690.1 68418.m07616 homeodomain-leucine zipper protein Revoluta (REV) / fascicular fiberless 1 (IFL1) identical to HD-zip transcription factor Revoluta (GI:9759333) {Arabidopsis thaliana}; contains Pfam profiles PF01852: START domain and PF00046: Homeobox domain Length = 842 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -2 Query: 172 RVTVVSPNPSSKRRQKPLRKLCSVLS 95 RV P PSS RRQ+ +R+ CS+L+ Sbjct: 39 RVYAECPKPSSLRRQQLIRE-CSILA 63 >At3g14250.1 68416.m01804 zinc finger protein-related contains weak similarity to zinc finger proteins and Pfam:PF01485 IBR domain Length = 308 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 104 RLECADCKVRSQVALKRCKHFELGGDKKRKGPDD 3 RL C CKV + C F+ G+ K+K D+ Sbjct: 212 RLFCVQCKVTWHAGI-GCDEFQRFGNTKKKSSDE 244 >At2g47090.1 68415.m05882 zinc finger (C2H2 type) family protein contains Prosite PS00028: Zinc finger, C2H2 type, domain Length = 745 Score = 25.8 bits (54), Expect = 8.1 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 289 SAGRTAKNVNATKYTRYHSTKSPR 218 S+G + + NATK +HS+ +P+ Sbjct: 461 SSGSSLSSANATKRNNHHSSSTPK 484 >At1g59790.1 68414.m06732 cullin-related low similarity to Hs-CUL-1 [Homo sapiens] GI:1381142 Length = 374 Score = 25.8 bits (54), Expect = 8.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 259 HLHFLQYVLRCFGTFTIFEFVR 324 H F+ YV+ CF T+F VR Sbjct: 338 HNKFIVYVIECFQNHTLFHKVR 359 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,386,981 Number of Sequences: 28952 Number of extensions: 140448 Number of successful extensions: 387 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 439384704 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -