BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p07f (567 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical ... 29 1.8 Z71177-7|CAI46554.1| 351|Caenorhabditis elegans Hypothetical pr... 29 2.3 U64848-5|AAB04884.1| 330|Caenorhabditis elegans Hypothetical pr... 28 5.4 Z66511-7|CAD57693.1| 567|Caenorhabditis elegans Hypothetical pr... 27 9.4 >AF016428-6|AAK71396.2| 1733|Caenorhabditis elegans Hypothetical protein T05C3.2 protein. Length = 1733 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 5/85 (5%) Frame = +1 Query: 64 YSFNLGERDVVFHLFHRGSP-QVSEPLLLSVNSIMTSSFSLARRTIFTIHNH----GETV 228 Y ++ ER+VV + +P + + +N+I S A + + HNH + + Sbjct: 292 YFMSVTEREVVHGILKVKNPNEHCLCYIRHINNIALSQMKTASKFVDIAHNHVNSEAQKL 351 Query: 229 AGNFNAFVIPAHLAAEDVNVIAVDW 303 N +PA LA +++ V+W Sbjct: 352 LANLRDERVPAKLAMQNIRRSTVEW 376 >Z71177-7|CAI46554.1| 351|Caenorhabditis elegans Hypothetical protein AC3.10 protein. Length = 351 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 11 KCTDWLSVRCYCALLLQRTVSIWENGMLYFTSFIGEALRS 130 K T W+ RC LL + + +W + +Y T IG ++S Sbjct: 19 KITGWILTRCLNVLLFIQLILLWWSLYMYVTVTIGYYVQS 58 >U64848-5|AAB04884.1| 330|Caenorhabditis elegans Hypothetical protein C50E3.9 protein. Length = 330 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +3 Query: 9 ENVRTG*VCAVTVRCYCSVQFQFGRTGCCISPLSSGKPSGQ*TVVAVCQLYYDF 170 ++V+T + +++ C V+ F CIS + KPS ++V LY D+ Sbjct: 132 KDVKTS-ISMLSLSCSIGVRILFSTVAICISLVYGSKPSLIKSIVLQLSLYLDY 184 >Z66511-7|CAD57693.1| 567|Caenorhabditis elegans Hypothetical protein F07A11.6d protein. Length = 567 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 480 PTYSSHYCSGPISPRLDSQP*NSQ 551 P+ SS SGP SP L+ +P NS+ Sbjct: 322 PSTSSSISSGPDSPPLEGEPLNSE 345 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,012,497 Number of Sequences: 27780 Number of extensions: 232774 Number of successful extensions: 745 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1176726318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -