BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p06f (609 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18170.1 68418.m02133 glutamate dehydrogenase 1 (GDH1) identi... 38 0.007 At3g03910.1 68416.m00405 glutamate dehydrogenase, putative simil... 38 0.007 At5g07440.1 68418.m00851 glutamate dehydrogenase 2 (GDH2) identi... 37 0.009 At1g51720.1 68414.m05828 glutamate dehydrogenase, putative simil... 31 0.79 At1g55830.1 68414.m06402 expressed protein similar to M-type 9 p... 29 1.8 At5g37110.1 68418.m04454 hypothetical protein 29 2.4 At4g01380.1 68417.m00178 plastocyanin-like domain-containing pro... 27 7.4 At1g30420.1 68414.m03718 ATP-binding cassette transport protein,... 27 7.4 At1g11990.1 68414.m01385 expressed protein contains Pfam PF03138... 27 7.4 At5g40910.1 68418.m04967 disease resistance protein (TIR-NBS-LRR... 27 9.7 At5g40470.1 68418.m04908 expressed protein 27 9.7 At4g10090.1 68417.m01651 expressed protein 27 9.7 At2g21300.1 68415.m02535 kinesin motor family protein contains P... 27 9.7 At2g05080.1 68415.m00530 hypothetical protein low similarity to ... 27 9.7 At2g04460.1 68415.m00450 expressed protein 27 9.7 >At5g18170.1 68418.m02133 glutamate dehydrogenase 1 (GDH1) identical to glutamate dehydrogenase 1 (GDH 1) [Arabidopsis thaliana] SWISS-PROT:Q43314 Length = 411 Score = 37.5 bits (83), Expect = 0.007 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 482 LEIQFPLRRDSGDYEMILGYRAQHSTHRTPTKGGIRFSTDV 604 ++++ + +D G +G+R QH R P KGGIR+ +V Sbjct: 35 IKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEV 75 >At3g03910.1 68416.m00405 glutamate dehydrogenase, putative similar to glutamate dehydrogenase 1 (GDH 1) [Arabidopsis thaliana] SWISS-PROT:Q43314 Length = 411 Score = 37.5 bits (83), Expect = 0.007 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 482 LEIQFPLRRDSGDYEMILGYRAQHSTHRTPTKGGIRFSTDV 604 ++++ + +D G +G+R QH R P KGGIR+ +V Sbjct: 35 IKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEV 75 >At5g07440.1 68418.m00851 glutamate dehydrogenase 2 (GDH2) identical to glutamate dehydrogenase 2 (GDH 2) [Arabidopsis thaliana] SWISS-PROT:Q38946 Length = 411 Score = 37.1 bits (82), Expect = 0.009 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 482 LEIQFPLRRDSGDYEMILGYRAQHSTHRTPTKGGIRFSTDV 604 ++++ + +D G +G+R QH R P KGGIR+ +V Sbjct: 35 IKVECTIPKDDGTLVSYIGFRVQHDNARGPMKGGIRYHPEV 75 >At1g51720.1 68414.m05828 glutamate dehydrogenase, putative similar to NADP-specific glutatamate dehydrogenase (NADP-GDH) SP:P28724 [Giardia lamblia (Giardia intestinalis)] Length = 637 Score = 30.7 bits (66), Expect = 0.79 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +2 Query: 455 KLMEPCDHILEIQFPLRRDSGDYEMILGYRAQHSTHRTPTKGGIRF 592 +L+EP + ++ + P D G+ + G+R Q + P +GGIRF Sbjct: 238 RLLEP-ERMIVFRVPWIDDRGETHVNRGFRVQFNQALGPCRGGIRF 282 >At1g55830.1 68414.m06402 expressed protein similar to M-type 9 protein (GI:507127) [Streptococcus pyogenes] Length = 509 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/60 (25%), Positives = 29/60 (48%) Frame = +2 Query: 359 HRACQVVEDKLVEDLKSRTPIEEKKKKVAGILKLMEPCDHILEIQFPLRRDSGDYEMILG 538 HR+ VV++ + ++K + + K + I + E + + RR++ DYE LG Sbjct: 422 HRSYAVVDEMVTREVKKDPAVRQVYKLLTSIHSIFEQISEKILMTDRFRRETVDYEKKLG 481 >At5g37110.1 68418.m04454 hypothetical protein Length = 1307 Score = 29.1 bits (62), Expect = 2.4 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 3/76 (3%) Frame = +2 Query: 278 SHEIPDKLKDIPTSANPKFFHMV-EYFFHRACQVVEDK--LVEDLKSRTPIEEKKKKVAG 448 S EIPDKLKD P+ F ++ E H C VV K +E+ K RT +KK Sbjct: 532 SAEIPDKLKD------PELFEVIKESMVHGPCGVVNPKCPCMENGKRRTDDFVEKKDFKC 585 Query: 449 ILKLMEPCDHILEIQF 496 + + P + L +++ Sbjct: 586 DNRYVIPYNRSLSLRY 601 >At4g01380.1 68417.m00178 plastocyanin-like domain-containing protein Length = 210 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 145 HHAASQEYRQVSGSAAQEFCSK*SPQ--YNVPNHTSW 249 H+ + QVSG+ EFC SP+ YN + SW Sbjct: 38 HNHNLNDVTQVSGALEYEFCDSSSPKAVYNPGHDISW 74 >At1g30420.1 68414.m03718 ATP-binding cassette transport protein, putative contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1488 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +2 Query: 203 VQNEAL-NTMFRIIPAGVNVCCRTYAS 280 + NE+L N + +P GVN+C YAS Sbjct: 207 LNNESLDNVEYDALPGGVNICPERYAS 233 >At1g11990.1 68414.m01385 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'growth regulator protein -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497.; expression supported by MPSS Length = 590 Score = 27.5 bits (58), Expect = 7.4 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 430 EKESSRYSKTYGTMRSHS*DSISSEARFWRLRNDIRLSRTTFHTQD 567 EK+ +Y+ TYG M S + D+++ R R N + T+D Sbjct: 118 EKQKMKYNGTYGRMLSLATDALAEGMRDNRYCNGFDFEQNKLETKD 163 >At5g40910.1 68418.m04967 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Non-consensus TT donor splice site at exon 1 Length = 1104 Score = 27.1 bits (57), Expect = 9.7 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = -3 Query: 271 CAAADIHSSWYDSEHCIEGFILNRILERRN---H*LGDILEMQH 149 C I + YDS+ C++ +L++IL +++ H LG I E H Sbjct: 238 CFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLH 281 >At5g40470.1 68418.m04908 expressed protein Length = 496 Score = 27.1 bits (57), Expect = 9.7 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = -3 Query: 343 HVEELRIRTCRNIFELIWNLMTSVC 269 ++EE+ +RTCR+I +++ ++ +C Sbjct: 250 NLEEIELRTCRSIVDVVLLKVSEIC 274 >At4g10090.1 68417.m01651 expressed protein Length = 262 Score = 27.1 bits (57), Expect = 9.7 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -1 Query: 195 LSGGTTDLAIFLRCSM-VAYYVKYDNRVRNRVALHLLNF*NKLIIFVSFMLDCSD 34 LS ++D IFL + ++Y + ++ +A H N N+L+ F M+ CSD Sbjct: 51 LSSNSSDALIFLAFARPFSHYDRILRKLGCNLATHKSN--NRLVFFDMLMVKCSD 103 >At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam profile: kinesin motor domain PF00225 Length = 862 Score = 27.1 bits (57), Expect = 9.7 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -2 Query: 605 LRPLRIEYLLWLESCVWNVVRDSLISFRNRQNRASEEIESQECDRM 468 LRPL + +L E+ W + D+ + +RN S + DR+ Sbjct: 31 LRPLNEKEILANEAADWECINDTTVLYRNTLREGSTFPSAYSFDRV 76 >At2g05080.1 68415.m00530 hypothetical protein low similarity to SP|Q9UUA2 DNA repair and recombination protein pif1, mitochondrial precursor {Schizosaccharomyces pombe} Length = 1238 Score = 27.1 bits (57), Expect = 9.7 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 278 SHEIPDKLKDIPTSANPKFFHMV-EYFFHRACQVVEDK 388 S EIPDKLKD P+ F ++ E H C VV K Sbjct: 399 SAEIPDKLKD------PELFEVIKEMMVHGPCGVVNPK 430 >At2g04460.1 68415.m00450 expressed protein Length = 148 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 280 TSVCAAADIHSSWYDSEHCIEGFILNRILERR 185 T+V A +++ W ++C +G ILNR++ R Sbjct: 69 TNVYAVGSMNT-WAQGDYCCKGLILNRLVHDR 99 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,607,035 Number of Sequences: 28952 Number of extensions: 280232 Number of successful extensions: 665 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 665 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -