BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p01r (709 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118590-1|AAM49959.1| 1858|Drosophila melanogaster LD45234p pro... 29 6.2 AF285759-1|AAG41905.1| 1330|Drosophila melanogaster d-spinophili... 29 6.2 AE014296-469|AAF47657.3| 2145|Drosophila melanogaster CG16757-PA... 29 6.2 >AY118590-1|AAM49959.1| 1858|Drosophila melanogaster LD45234p protein. Length = 1858 Score = 29.1 bits (62), Expect = 6.2 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = -1 Query: 493 EIENDSEVGSISWVEYPAELDEDGNGLVXVDLPIEAQPEDLEKAQLVDLXVENVAEPED 317 E++ S VG Y A + + +GLV + E PE+ E AQL+ L ++ E E+ Sbjct: 1046 EVDGKSLVGVTQ--AYAASVLRNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEE 1102 >AF285759-1|AAG41905.1| 1330|Drosophila melanogaster d-spinophilin, core domains protein. Length = 1330 Score = 29.1 bits (62), Expect = 6.2 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = -1 Query: 493 EIENDSEVGSISWVEYPAELDEDGNGLVXVDLPIEAQPEDLEKAQLVDLXVENVAEPED 317 E++ S VG Y A + + +GLV + E PE+ E AQL+ L ++ E E+ Sbjct: 512 EVDGKSLVGVTQ--AYAASVLRNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEE 568 >AE014296-469|AAF47657.3| 2145|Drosophila melanogaster CG16757-PA protein. Length = 2145 Score = 29.1 bits (62), Expect = 6.2 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = -1 Query: 493 EIENDSEVGSISWVEYPAELDEDGNGLVXVDLPIEAQPEDLEKAQLVDLXVENVAEPED 317 E++ S VG Y A + + +GLV + E PE+ E AQL+ L ++ E E+ Sbjct: 1327 EVDGKSLVGVTQ--AYAASVLRNTSGLVKFQIGRERDPENSEVAQLIRLSLQADREKEE 1383 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,408,351 Number of Sequences: 53049 Number of extensions: 317817 Number of successful extensions: 884 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3128965752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -