BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o24f (436 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33308| Best HMM Match : Ribosomal_L34e (HMM E-Value=9e-07) 53 9e-08 SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06) 30 0.72 SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) 29 2.2 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 29 2.2 SB_979| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.9 SB_22814| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.0 SB_50855| Best HMM Match : Ras (HMM E-Value=0) 27 6.7 SB_800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_9363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_33308| Best HMM Match : Ribosomal_L34e (HMM E-Value=9e-07) Length = 58 Score = 53.2 bits (122), Expect = 9e-08 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = +2 Query: 203 RPAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQK 328 RP + + +KTV R YGG C CVK+RI+RAFLIEEQK Sbjct: 2 RPMKLMHISKPQKTVSRAYGGSRCAACVKERIIRAFLIEEQK 43 >SB_41650| Best HMM Match : RVT_1 (HMM E-Value=1.6e-06) Length = 299 Score = 30.3 bits (65), Expect = 0.72 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 49 IQATTVVQHKIKSKKNSKDTGWPLGLSV 132 I VQH K+KK + DT +P+G++V Sbjct: 45 ISGEYAVQHSCKNKKETIDTDYPIGMAV 72 >SB_19489| Best HMM Match : TP2 (HMM E-Value=0.58) Length = 429 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 56 RRLSYNTKSNQRRIVRTPGGRLVYQYVKKP 145 RR++ T SN R++RTP G+ ++ VK P Sbjct: 159 RRITKTTNSNSTRLIRTP-GQSIHIKVKAP 187 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 28.7 bits (61), Expect = 2.2 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = +1 Query: 10 PAVKKLENGAAAYIQATTVVQHKIKSKKNSKDTGWPLGLSVCKKAQEDPKVWSVQEQTPW 189 P VK+ ++AYI T+ + K+K+K T P V K A E+ K + +++ P+ Sbjct: 494 PVVKR---ASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLNDEQKKPY 550 >SB_979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -1 Query: 292 LLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEFALALTTPW 155 L+D + + + + HCF+T+ T T ++ S T F L +PW Sbjct: 542 LIDELVKQSSCPSRAHCFITMTTTQTSTKISIAPTNTFFL---SPW 584 >SB_22814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 27.5 bits (58), Expect = 5.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 137 LHTDKPSGHPVSLLFFFDLI 78 LHT +P+GHP ++ FD I Sbjct: 5 LHTTEPTGHPCHIVCCFDAI 24 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 27.1 bits (57), Expect = 6.7 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -1 Query: 301 DNALLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEF 179 DN LL + T +N FL + K G + L+ TEF Sbjct: 155 DNGLLFMETSAKTAMNVNDIFLAIGKKGKKKKGKTLNLTEF 195 >SB_800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 26.6 bits (56), Expect = 8.8 Identities = 14/60 (23%), Positives = 25/60 (41%) Frame = +2 Query: 5 CHQLSKSLKMVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKL 184 C L+ + ++ T + +Y K N +V P G Q ++ CG K++L Sbjct: 36 CSALTSTSALIDHTTIKLFGTYEEKGNLFFVVVAPSGSDKIQPARRVASTRSCGNSKTRL 95 >SB_9363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 26.6 bits (56), Expect = 8.8 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 278 YGRGHHH-KHVSLFSYGSKDGNVQQV*LAGYHGVCSCTDHTL 156 YG H K + L YG+ G V+++ L GY HTL Sbjct: 238 YGTSHGLVKEIDLRGYGTSHGPVKEIELRGYGTSYRGPSHTL 279 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,044,896 Number of Sequences: 59808 Number of extensions: 270843 Number of successful extensions: 754 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 834771332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -