BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o21r (558 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1827.06c |||aspartate semialdehyde dehydrogenase|Schizosacch... 31 0.15 SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase Ubp14|Sch... 26 4.3 SPBC18E5.10 |||iron sulfur cluster assembly protein |Schizosacch... 25 5.7 >SPCC1827.06c |||aspartate semialdehyde dehydrogenase|Schizosaccharomyces pombe|chr 3|||Manual Length = 357 Score = 30.7 bits (66), Expect = 0.15 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 211 RFTKVKPTPPPVRRTLANCVDPRTRTALTRLPAGAVYL 324 +F K PTP VR LAN V + P A+Y+ Sbjct: 254 KFAKTSPTPDQVREVLANYVSEPQKLGCYSAPKQAIYV 291 >SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase Ubp14|Schizosaccharomyces pombe|chr 2|||Manual Length = 775 Score = 25.8 bits (54), Expect = 4.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 46 IRESLIKKNGENEFFVQTKKQKLRVFACKRPEYA 147 IR+S I K + F +QKL +CKR Y+ Sbjct: 420 IRKSSIAKTDITKIFDFETEQKLSCLSCKRVRYS 453 >SPBC18E5.10 |||iron sulfur cluster assembly protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 25.4 bits (53), Expect = 5.7 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +1 Query: 412 LKALDLSVDLGSATSLVDTATIAVNTNNRANFILQETC 525 LKALD S+ GS L D I + N A F TC Sbjct: 340 LKALDSSLGTGSVIVLNDHDQIFESLLNFAKFYSTNTC 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,940,388 Number of Sequences: 5004 Number of extensions: 34768 Number of successful extensions: 95 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 233995432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -