BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o18f (502 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8ID75 Cluster: Putative uncharacterized protein PF13_0... 33 2.7 UniRef50_Q4HN36 Cluster: Conserved hypothetical secreted protein... 32 8.3 >UniRef50_Q8ID75 Cluster: Putative uncharacterized protein PF13_0333; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PF13_0333 - Plasmodium falciparum (isolate 3D7) Length = 1024 Score = 33.5 bits (73), Expect = 2.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 392 IQHYIHNNYLIPVVYEISNNTIILYKLLIQ*ICF 493 + +Y H +Y P +Y+I N + LYK L IC+ Sbjct: 510 MDNYDHQSYNFPTLYDIKNYVVTLYKELYTHICY 543 >UniRef50_Q4HN36 Cluster: Conserved hypothetical secreted protein, putative; n=1; Campylobacter lari RM2100|Rep: Conserved hypothetical secreted protein, putative - Campylobacter lari RM2100 Length = 492 Score = 31.9 bits (69), Expect = 8.3 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 416 SYYEYNVEYSELFGFQSQSYIKNSTQ 339 SY E+N++YS+LFG+ SQ N TQ Sbjct: 53 SYDEFNLKYSQLFGYYSQLNNGNYTQ 78 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 324,895,317 Number of Sequences: 1657284 Number of extensions: 4963085 Number of successful extensions: 10921 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10919 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29691847201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -