BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o16f (601 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0774 - 6004040-6004371,6004634-6005215,6005391-6005657,600... 30 1.2 02_01_0077 - 546033-546223,546314-546566,546635-546865,547165-54... 27 8.7 >01_01_0774 - 6004040-6004371,6004634-6005215,6005391-6005657, 6005845-6006163 Length = 499 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +2 Query: 425 LVCAREYFGDHIKCLSDQGVPDHVIQTYCFFM----ATFTIVRHYNESLLQGE 571 +V A F DH K +G+ ++T CFFM AT ++ +N +L GE Sbjct: 206 VVVASAIFNDHDKIRQPKGLGSETLRTVCFFMFIDDATHRVLASHN--ILAGE 256 >02_01_0077 - 546033-546223,546314-546566,546635-546865,547165-547331, 547369-548008 Length = 493 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 355 EDRECGLQAALPADCDDFAGFRDPGLR-*RVFRGSHQMSFGSG 480 ED+ CG A GFRDP LR ++ RG S GSG Sbjct: 218 EDKLCGYAAEKLGIARSIPGFRDPRLRSGQLRRGVSFASAGSG 260 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,059,635 Number of Sequences: 37544 Number of extensions: 269655 Number of successful extensions: 608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -