BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o14r (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 35 0.069 SB_58821| Best HMM Match : RecR (HMM E-Value=1.6) 29 3.4 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 34.7 bits (76), Expect = 0.069 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -3 Query: 659 LINVLGRLKCDEDPPHLYMQTFVLKPLGD--SFYVQHDIFR 543 ++ V G L + P +MQTFVL P D +YV +DIFR Sbjct: 90 VVQVSGELSNNGQPMRKFMQTFVLAPGEDIRKYYVHNDIFR 130 >SB_58821| Best HMM Match : RecR (HMM E-Value=1.6) Length = 223 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = -3 Query: 425 IIFFLYLFRQRIYEIERTRRL*NYDNDRFSDRTG*SKMRIWFSLHRKW 282 I + LY+ +QR+ +IE + + N DND + + +K+R + K+ Sbjct: 20 IKYILYIIKQRLEDIEFQKWISNVDNDNRNKQGQSNKLRTYRKFKSKY 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,393,240 Number of Sequences: 59808 Number of extensions: 404128 Number of successful extensions: 685 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -