BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o14f (515 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 2.6 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 24 3.5 AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synth... 23 6.1 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 23 8.1 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 23 8.1 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/39 (20%), Positives = 20/39 (51%) Frame = +2 Query: 281 LTFQKITRIVTAVDSQPMFDGGVLINVLGRLKCDEDPPH 397 LT+ + I+ ++D+ P + + ++V+G + H Sbjct: 149 LTYHQFQAIIASMDAPPQPEAAITLDVIGNANTPQYDDH 187 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 140 VQQYYTLFDDPAQRANLVNMYNVET 214 + + YT+FD+ + N+Y VET Sbjct: 529 LNELYTIFDELTDSKSNSNIYKVET 553 >AJ010904-1|CAA09390.1| 142|Anopheles gambiae nitric oxide synthase protein. Length = 142 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 320 DSQPMFDGGVLINVLGRLKCDEDPPHLYMQTFVLK 424 + + M GVL V L +E+ P Y+Q LK Sbjct: 42 EKEEMVQKGVLDRVFLALSREENIPKTYVQDLALK 76 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 22.6 bits (46), Expect = 8.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 416 VLKPLGDSFYVQHDIFRL 469 +L P GD F V++D+F + Sbjct: 598 MLVPKGDQFGVEYDLFAM 615 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 464 GKCRAEHKMNLRVASTRTFACIGVEDLRH 378 GKCR+ H +V +F E++RH Sbjct: 748 GKCRSIHLHRGQVLDADSFRANEQEEIRH 776 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,304 Number of Sequences: 2352 Number of extensions: 11171 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -