BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o12f (540 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 27 0.14 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.56 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 2.3 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 21 9.2 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 21 9.2 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 26.6 bits (56), Expect = 0.14 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +1 Query: 127 LPRCQRWRCPQWPWHLANYMSQPPTKLPRSPPSSKRGSLEPRP 255 +P C W + + PPT PR S+R PRP Sbjct: 228 VPECADWYKGRLTDEQLKELENPPTPKPRPTKVSRRKPRPPRP 270 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.56 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = -1 Query: 297 HQCSRHDQSLLDQPWARLQGSSLRGWWRSRQLCGWLRHVVCE 172 H C+ + + +L + + L W + R++C W + CE Sbjct: 1113 HNCNAYYRCVLGELRKQYCAGGLH-WNKERKICDWPKSAKCE 1153 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 2.3 Identities = 7/26 (26%), Positives = 16/26 (61%) Frame = +3 Query: 321 LKNIQAEEMVEFSSGLKGMALNLEPD 398 +KN +++F+ GLK + +++ D Sbjct: 575 IKNFNIPSILQFNDGLKNLEIHVTKD 600 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 20.6 bits (41), Expect = 9.2 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +3 Query: 303 IARVYGLKNIQA 338 + R+YG++N+QA Sbjct: 363 VLRLYGIENLQA 374 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 527 TQSIYYTPKDLLSDGNVYD 471 TQ Y PKD ++ ++YD Sbjct: 75 TQKGYLIPKDTITIIHIYD 93 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,438 Number of Sequences: 336 Number of extensions: 2782 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13201902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -