BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o06r (564 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006807-4|AAK84618.1| 904|Caenorhabditis elegans Hypothetical ... 30 1.3 U42436-3|AAL02471.1| 498|Caenorhabditis elegans Hypothetical pr... 29 1.7 U42436-2|AAL02470.2| 552|Caenorhabditis elegans Hypothetical pr... 29 1.7 >AC006807-4|AAK84618.1| 904|Caenorhabditis elegans Hypothetical protein Y58A7A.4 protein. Length = 904 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/69 (28%), Positives = 35/69 (50%) Frame = +1 Query: 322 VNLTLRTRQLIVAARLTTKLRKSLSLEVILPILKALALSVDLGSATSLVDTATIAVNTNN 501 + + RTR L + +L + K+ L + ILK L LG+A LV+ T ++ N Sbjct: 786 MRICARTRDLRLDIKLRNRFLKAEQLLIKNGILKTEILENLLGTALYLVENVTAWMHMTN 845 Query: 502 RANFILQEI 528 R + L+++ Sbjct: 846 RKDKSLKDL 854 >U42436-3|AAL02471.1| 498|Caenorhabditis elegans Hypothetical protein C49H3.6b protein. Length = 498 Score = 29.5 bits (63), Expect = 1.7 Identities = 21/92 (22%), Positives = 43/92 (46%), Gaps = 3/92 (3%) Frame = +1 Query: 232 KPTPPPVRRTLVNCVDPRTRTALTRLPAGAVNLTLRTRQLIVAARLTTKLRKSLSLEV-I 408 +P PPPV R + P ++ L R P AV + + ++ + +++S V Sbjct: 356 QPAPPPVARLPNSATFPTEKSRLPRAPPPAVTTPVPRMSIGSLPASSSNVPRTMSSPVKK 415 Query: 409 LPIL--KALALSVDLGSATSLVDTATIAVNTN 498 P++ + A+ +AT+ + T ++ NT+ Sbjct: 416 TPVMGVSSTAVRRPQSAATTTMPTTSVITNTS 447 >U42436-2|AAL02470.2| 552|Caenorhabditis elegans Hypothetical protein C49H3.6a protein. Length = 552 Score = 29.5 bits (63), Expect = 1.7 Identities = 21/92 (22%), Positives = 43/92 (46%), Gaps = 3/92 (3%) Frame = +1 Query: 232 KPTPPPVRRTLVNCVDPRTRTALTRLPAGAVNLTLRTRQLIVAARLTTKLRKSLSLEV-I 408 +P PPPV R + P ++ L R P AV + + ++ + +++S V Sbjct: 356 QPAPPPVARLPNSATFPTEKSRLPRAPPPAVTTPVPRMSIGSLPASSSNVPRTMSSPVKK 415 Query: 409 LPIL--KALALSVDLGSATSLVDTATIAVNTN 498 P++ + A+ +AT+ + T ++ NT+ Sbjct: 416 TPVMGVSSTAVRRPQSAATTTMPTTSVITNTS 447 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,955,837 Number of Sequences: 27780 Number of extensions: 237445 Number of successful extensions: 611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1166125180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -