BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o04r (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 75 7e-14 SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) 29 3.6 SB_46961| Best HMM Match : DUF663 (HMM E-Value=0) 29 3.6 SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_18738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 74.5 bits (175), Expect = 7e-14 Identities = 35/56 (62%), Positives = 39/56 (69%) Frame = -3 Query: 699 KGKMRNRRRIQRKGPLIIFNKDQVLTRAFRNIPGVEXXXXXXXXXXXLAPGGHLGR 532 KGKMRNRR + RKGPLII+N DQ L +AFRN+PGVE L PGGHLGR Sbjct: 190 KGKMRNRRTVMRKGPLIIYNNDQGLRQAFRNLPGVELQHVDRLNLLKLCPGGHLGR 245 Score = 48.8 bits (111), Expect = 4e-06 Identities = 34/82 (41%), Positives = 43/82 (52%) Frame = -3 Query: 444 NLPQPKMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLNPLTNNKAMLKLNPYAAVLKR 265 NLP ++ + D LLK + R P R RA K NPL N ML+LNPYA KR Sbjct: 220 NLPGVELQHVDRLNLLKLCPGGHLGR-PKAR--RAIHKKNPLKNLGTMLRLNPYAKSAKR 276 Query: 264 KAILELRRRKNLKALADAEKSG 199 +L + RR+ K A A+K G Sbjct: 277 AEMLTVERRRAAKEAALAKKRG 298 >SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1718 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/49 (28%), Positives = 29/49 (59%) Frame = -3 Query: 471 TPSKQKKNFNLPQPKMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLN 325 TP++Q F + +++N D++RL S+ + ++ N RVI+++ N Sbjct: 802 TPTEQDAEFTANEAEVSNQDISRLSSSEPSPIIPKSINNRVIKSSALSN 850 >SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 30.7 bits (66), Expect = 1.2 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = -2 Query: 460 TKEELQPAPTEDGQH*PHTSSQV**DQEGPPCSQQTRDPCYTQIE--PAH*QQGDAETQS 287 ++++ P P++ +H P S Q Q P SQQ R P +Q + P H QQ ETQS Sbjct: 206 SQQQRHPRPSQQQRH-PRPSQQ----QRYPRPSQQQRQPRPSQQQRYPRHNQQQTPETQS 260 Query: 286 LRGRAEEES 260 E +S Sbjct: 261 TTEIPETQS 269 >SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) Length = 1566 Score = 29.1 bits (62), Expect = 3.6 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 6/72 (8%) Frame = -3 Query: 336 RKLNPLTNNK-----AMLKLNPYAAVLKRKA-ILELRRRKNLKALADAEKSGLKLSKRNP 175 RK P NK A + Y A +R A +E+RR++ K L EK +L R Sbjct: 87 RKSAPFATNKDVRHQAYQHIRDYEADKRRLADSIEIRRQEQAKTLE--EKKRQRLRSREA 144 Query: 174 AMKAEKLRERRR 139 AM+ ++ +ER R Sbjct: 145 AMEEKRQKERLR 156 >SB_46961| Best HMM Match : DUF663 (HMM E-Value=0) Length = 491 Score = 29.1 bits (62), Expect = 3.6 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 2/76 (2%) Frame = -3 Query: 357 KRVIRATRKLNPLTNNKAMLKLNPYAAVLK--RKAILELRRRKNLKALADAEKSGLKLSK 184 K V R TR+ NPL K + K P+ + K +K K + EK L + Sbjct: 369 KPVERQTRRFNPLVIPKKLQKDLPFKSKPKDAKKRQRPSLESKRAVVMEPQEKKVYSLMQ 428 Query: 183 RNPAMKAEKLRERRRK 136 + EKLR+R+ K Sbjct: 429 QLYTANKEKLRKRKEK 444 >SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -3 Query: 396 KSDEIRKVLRAPNKRV---IRATRKLNPLTNNKAMLKL 292 +SD I K+ NK++ ++ L+ LTNNKA LKL Sbjct: 27 QSDVIHKIPNEANKQIGLRVKCLALLDYLTNNKAQLKL 64 >SB_18738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 396 Score = 27.9 bits (59), Expect = 8.4 Identities = 24/99 (24%), Positives = 44/99 (44%) Frame = -3 Query: 453 KNFNLPQPKMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLNPLTNNKAMLKLNPYAAV 274 K N +P++ + L L D I + PNK +T + NP+ ++K PY + Sbjct: 132 KQPNPSKPELVCSSLLSL--QDAINRAAVEPNKT---STTE-NPIERQSFLVKNRPYFTM 185 Query: 273 LKRKAILELRRRKNLKALADAEKSGLKLSKRNPAMKAEK 157 L++ EL+++ L + + S PA A++ Sbjct: 186 LRKSYDKELKKKAVFLCLIVSNPKKIDESCPKPASAADE 224 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,117,932 Number of Sequences: 59808 Number of extensions: 343861 Number of successful extensions: 1322 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1309 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -