BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o04f (578 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.3 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 5.7 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 5.7 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 7.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 Query: 254 CVSKEAGHQTSAESW 298 C K+ GH+ S SW Sbjct: 1152 CEEKKPGHKPSTSSW 1166 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.3 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 187 AHTSGPGQ*CSRFYVQELEAALLREQGGWSPNQCRIMGYR 306 A TSG G+ FY+ E + + G S N I +R Sbjct: 1376 AQTSGGGENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFR 1415 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.3 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 187 AHTSGPGQ*CSRFYVQELEAALLREQGGWSPNQCRIMGYR 306 A TSG G+ FY+ E + + G S N I +R Sbjct: 1376 AQTSGGGENKPIFYLDEAFQRRVTQIGSTSSNNPSISAFR 1415 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 5.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 169 PVRIQGAHTSGPGQ*CSRFYVQELEAAL 252 PVRI G H G C++ E AL Sbjct: 196 PVRIMGVHRPGFDNDCNKNTSTSKEIAL 223 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 155 HPAPSHSSLNTPTL 114 HPA +HS+L +P + Sbjct: 121 HPAAAHSALLSPAM 134 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 7.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 280 NQCRIMGYRTCCCPN 324 +Q R G TC CPN Sbjct: 281 SQRRYTGRATCDCPN 295 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,592 Number of Sequences: 336 Number of extensions: 2898 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -