BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o03r (652 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119565-1|AAM50219.1| 637|Drosophila melanogaster HL01076p pro... 28 9.6 AE014297-1438|AAF54736.1| 637|Drosophila melanogaster CG3132-PA... 28 9.6 >AY119565-1|AAM50219.1| 637|Drosophila melanogaster HL01076p protein. Length = 637 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +2 Query: 14 NQHISDGIPVQSNAGSNEIKTSSEYAMKRHFNTTPIFLFNLVTLSVEW 157 +Q + DG P + AGS + +RH T N VT VEW Sbjct: 31 DQFLKDGEPFRFIAGSFHYFRAHPATWQRHLRTMRAAGLNAVTTYVEW 78 >AE014297-1438|AAF54736.1| 637|Drosophila melanogaster CG3132-PA protein. Length = 637 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +2 Query: 14 NQHISDGIPVQSNAGSNEIKTSSEYAMKRHFNTTPIFLFNLVTLSVEW 157 +Q + DG P + AGS + +RH T N VT VEW Sbjct: 31 DQFLKDGEPFRFIAGSFHYFRAHPATWQRHLRTMRAAGLNAVTTYVEW 78 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,860,129 Number of Sequences: 53049 Number of extensions: 626987 Number of successful extensions: 1561 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1561 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2765538900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -