BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o03f (613 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) 28 6.9 SB_2694| Best HMM Match : LIM (HMM E-Value=6.6e-14) 27 9.1 >SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) Length = 4607 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = -3 Query: 299 MLQNVNCLDVEITEKIVFFKIDDLAKILRTIIISKQYLQF 180 + ++N DV++ +K + DDLA I++ + +SK+ + F Sbjct: 957 LFDSINQKDVQMVDKTI---TDDLADIMKELSVSKELVDF 993 >SB_2694| Best HMM Match : LIM (HMM E-Value=6.6e-14) Length = 446 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -3 Query: 509 DCRVSLTKTH---HTGRSDTVVIDQRRMDEIP 423 DCR L T+ H G+ T ++ QRR+ P Sbjct: 73 DCRKKLDSTNAASHDGKCHTTIVTQRRLSRCP 104 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,796,943 Number of Sequences: 59808 Number of extensions: 379710 Number of successful extensions: 770 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 770 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -