BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11o02r (751 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 4.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 4.0 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 4.0 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.3 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 7.1 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 7.1 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 21 9.3 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 21 9.3 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 21 9.3 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 9.3 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -3 Query: 437 YMRLILELGIVLTFDRKLWIEVFKE 363 ++ LEL +V TFD + W + K+ Sbjct: 4 FVNYALELLVVKTFDSETWEAIKKD 28 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 693 TLLQVVDNHVIKYIPPEEYKPMIKSNVKW 607 T + V +N Y+PP +K K ++ W Sbjct: 126 TNVVVKNNGTCLYVPPGIFKSTCKIDITW 154 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -3 Query: 437 YMRLILELGIVLTFDRKLWIEVFKE 363 ++ LEL +V TFD + W + K+ Sbjct: 4 FVNYALELLVVKTFDSETWEAIKKD 28 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 693 TLLQVVDNHVIKYIPPEEYKPMIKSNVKW 607 T + V N Y+PP +K K ++ W Sbjct: 89 TSVVVTHNGSCLYVPPGIFKSTCKIDITW 117 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 693 TLLQVVDNHVIKYIPPEEYKPMIKSNVKW 607 T + V N Y+PP +K K ++ W Sbjct: 157 TNVVVTHNGSCLYVPPGIFKSTCKIDITW 185 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 693 TLLQVVDNHVIKYIPPEEYKPMIKSNVKW 607 T + V N Y+PP +K K ++ W Sbjct: 157 TNVVVTHNGSCLYVPPGIFKSTCKIDITW 185 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 657 YIPPEEYKPMIKSNVKW 607 Y+PP +K K +V W Sbjct: 101 YVPPGIFKSTCKMDVAW 117 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 9.3 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -2 Query: 213 TLRGVKILRIDTKYNVIWTLGVAIPGETGAMCYLFDTV 100 T RG+ T + + W + + G + Y FDTV Sbjct: 199 TARGMLPDPKKTPFLISWGIAQVVTTVAGIVSYPFDTV 236 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 9.3 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -2 Query: 213 TLRGVKILRIDTKYNVIWTLGVAIPGETGAMCYLFDTV 100 T RG+ T + + W + + G + Y FDTV Sbjct: 199 TARGMLPDPKKTPFLISWGIAQVVTTVAGIVSYPFDTV 236 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -2 Query: 663 IKYIPPEEYKPMIKSNVKWVEKQKYGCIL 577 + + PP YK + NV++ + CI+ Sbjct: 146 VSWKPPAIYKSSCEINVEYFPFDEQSCIM 174 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,885 Number of Sequences: 438 Number of extensions: 5279 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -