BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n24r (615 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52499| Best HMM Match : COX5A (HMM E-Value=0) 149 2e-36 SB_39596| Best HMM Match : TTL (HMM E-Value=0) 30 1.7 SB_28305| Best HMM Match : MMR_HSR1 (HMM E-Value=0.0054) 28 5.2 SB_56875| Best HMM Match : LON (HMM E-Value=0) 28 6.9 SB_42515| Best HMM Match : TPR_2 (HMM E-Value=2e-14) 28 6.9 SB_41990| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) 28 6.9 SB_56923| Best HMM Match : PT (HMM E-Value=0.95) 28 6.9 SB_48438| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_22247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_12631| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_28446| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_52499| Best HMM Match : COX5A (HMM E-Value=0) Length = 208 Score = 149 bits (361), Expect = 2e-36 Identities = 70/107 (65%), Positives = 83/107 (77%), Gaps = 1/107 (0%) Frame = -2 Query: 458 PVESDEEFDNRYEAYFNRKDIDGWEIRKGMNDLCGMDLVPDPKIIKAALHACRRVNDYAL 279 PVES+E FD R+EAYF+R DID WE+R+G+N+L G DLVP+PKII A HACRR+NDY Sbjct: 104 PVESEEAFDARWEAYFSRPDIDAWELRRGLNELYGHDLVPEPKIINAMFHACRRLNDYGT 163 Query: 278 AVRFIEACKDK-CGNKVNEIYPYIIQEIKPTLTELGIDTPEELGYDK 141 VR +EA KDK GNK EIYPYI+Q+ KP + ELGI TPEELG K Sbjct: 164 TVRILEAVKDKAAGNK--EIYPYILQQCKPVMEELGILTPEELGLAK 208 >SB_39596| Best HMM Match : TTL (HMM E-Value=0) Length = 808 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -1 Query: 555 EIRIRCVCKCP*KI-ISSCREGQRRICTEITRRSSGK 448 ++RI + KC + I CREG R CTE+ R S K Sbjct: 434 DLRIYVLVKCLDPLEIYVCREGMGRFCTEVYRPPSQK 470 >SB_28305| Best HMM Match : MMR_HSR1 (HMM E-Value=0.0054) Length = 425 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 141 LIVAKLLRCVNTQFGESRLDLLNDVWVDFIHFVSTFVFAGFYKPD 275 L++ +L +N+ +SRL + +D V F F TF F Y PD Sbjct: 364 LVLVVILVALNSGLIKSRLVVHDDAVVWFAKFSQTFSFVCGYMPD 408 >SB_56875| Best HMM Match : LON (HMM E-Value=0) Length = 925 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 390 LGNPQRNE*PLWYGSRSRPKDYQSCPSCMQTS 295 +GN + N P W RS+ KD QS P T+ Sbjct: 846 IGNVKSNPKPFWQFIRSQRKDSQSMPPLKATN 877 >SB_42515| Best HMM Match : TPR_2 (HMM E-Value=2e-14) Length = 1104 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 213 VWVDFIHFVSTFVFAGFYKPDCKGIIIDSSACMKGSFDNL 332 +W D HF S + + C G I D+S C+K +L Sbjct: 445 LWKDKSHFKSALASLLYNRASCLGRIGDASGCVKDCTSSL 484 >SB_41990| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) Length = 455 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 390 LGNPQRNE*PLWYGSRSRPKDYQSCPSCMQTS 295 +GN + N P W RS+ KD QS P T+ Sbjct: 376 IGNVKSNPKPFWQFIRSQRKDSQSMPPLKATN 407 >SB_56923| Best HMM Match : PT (HMM E-Value=0.95) Length = 441 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -2 Query: 182 ELGIDTPEELGYDKPELALES 120 ELG+D EEL D PEL L S Sbjct: 242 ELGVDLQEELNRDAPELMLLS 262 >SB_48438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 27.9 bits (59), Expect = 6.9 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 332 LGRERDPYHRGHSFLCG 382 +GRE PY + HS++CG Sbjct: 248 IGREIQPYSKPHSYVCG 264 >SB_22247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 752 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 153 WLR*ARTRFRKCLPHVKLLTYAVVKL 76 ++R TRFR C+P K+L A+ +L Sbjct: 104 YIRRQNTRFRNCIPPEKILAVALYRL 129 >SB_12631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 153 WLR*ARTRFRKCLPHVKLLTYAVVKL 76 ++R TRFR C+P K+L A+ +L Sbjct: 104 YIRRQNTRFRNCIPPEKILAVALYRL 129 >SB_28446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 595 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 469 HTEVQWKVMKNSITDMKHISTEKTLMVGKSAKE 371 HT + KNS T +KH+ T +G SAKE Sbjct: 176 HTGARKAFTKNSRTLLKHVKEIATKSMGDSAKE 208 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,974,343 Number of Sequences: 59808 Number of extensions: 386988 Number of successful extensions: 809 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 808 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -