BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n22r (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0014 - 19267601-19267831,19268338-19268454,19268733-192688... 31 1.1 03_04_0101 - 17283293-17284009 29 2.4 07_03_1545 - 27599605-27599859,27600012-27600123,27600216-27600478 29 4.2 04_04_0116 + 22877296-22877482,22877578-22877627,22879057-228791... 29 4.2 06_01_0185 - 1437693-1437834,1437969-1438078,1438214-1438264,143... 28 5.6 05_03_0328 - 12468142-12468262,12468443-12468641,12468758-124689... 28 5.6 02_05_1289 - 35470076-35470243,35471032-35471108,35471935-354719... 28 5.6 01_06_0138 + 26865895-26865953,26866628-26867870 28 7.4 06_03_0712 + 23803597-23803945,23804118-23805479,23805743-238058... 27 9.8 06_01_0389 + 2779790-2779891,2780378-2781912,2782087-2782135,278... 27 9.8 05_03_0459 - 14284513-14286336 27 9.8 02_05_0423 - 28834380-28835852,28836987-28837109 27 9.8 >11_06_0014 - 19267601-19267831,19268338-19268454,19268733-19268890, 19269501-19269612,19269721-19269908,19270344-19270436, 19270521-19270708,19271635-19271720,19272662-19272811, 19273930-19274065,19274143-19274222,19275546-19275626, 19276114-19276245,19276490-19276610,19277457-19277518, 19277846-19277974,19278514-19278573,19278689-19278772, 19278852-19279532 Length = 962 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -3 Query: 171 DEEFRVALENLQSEEWDAVFGALWESEQFKAEVDTLAEHGIDVHVLMKELFAIFGQN 1 D + + N E + VF +L ++ F+A++DT EHG D + + + A F N Sbjct: 348 DSDAQTEKRNAAQEIFSPVFSSLLDALLFRAQIDT-DEHGTDGELCIPDGLAQFRMN 403 >03_04_0101 - 17283293-17284009 Length = 238 Score = 29.5 bits (63), Expect = 2.4 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = -3 Query: 633 PGKMKVAIVFMGLIALGFSLPQPKKSFVENFRDFLDIIKDEAGHDIEHLFEHY 475 PG ++ A MGL+A ++LP P +E+ R L + D+ HD LF Y Sbjct: 81 PGAIRAA---MGLVASVYALPPPHAGTLEDARLILGKVFDD-HHDATWLFRLY 129 >07_03_1545 - 27599605-27599859,27600012-27600123,27600216-27600478 Length = 209 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 8 PKMAKSSFMRTCTSIPCSARVSTSALNCSLSHRAP 112 P MA + R C SI S R AL L HR P Sbjct: 46 PLMALNHISRLCKSIDASVRFYVKALGFVLIHRPP 80 >04_04_0116 + 22877296-22877482,22877578-22877627,22879057-22879180, 22879266-22879373,22879462-22880084 Length = 363 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 300 IGERVKRARHTLSGRDFTSYIND 232 +G+R+ R R L G+ + +YIND Sbjct: 92 VGQRIARGRFVLDGKVYHTYIND 114 >06_01_0185 - 1437693-1437834,1437969-1438078,1438214-1438264, 1438877-1439122,1439244-1439315,1439614-1439648, 1439755-1439845,1440546-1440610,1440733-1440813, 1441020-1441137,1441535-1441627,1441865-1441997, 1442471-1442503,1443264-1443343,1443444-1443549, 1443621-1443795,1443884-1443980,1444819-1445251, 1445329-1445459,1446052-1446341,1446429-1447002 Length = 1051 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 67 GINFGLELLTLPQSTEHGV-PFLALKVLKSYSKFFVLSEFLFVQG 198 G + G L+ PQ EH + PFLALK+ + + +L + ++G Sbjct: 672 GDDCGDSSLSAPQREEHRIGPFLALKIFHTNREILLLKAYSGLKG 716 >05_03_0328 - 12468142-12468262,12468443-12468641,12468758-12468974, 12469896-12469994,12470843-12470899,12470943-12472577 Length = 775 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = -3 Query: 252 FTSYINDIIGEFPKDKLAALYEQKLAEDEEFRVALENLQSEEWDAVFGALWESEQFKAEV 73 F Y+ I E D+ LYE+ L + +V + + E + G ESE+ K EV Sbjct: 596 FNEYLQFEIDENEFDRTRELYERLLDRTKHLKVWISYTEFEASAGLAGEDGESEEIKKEV 655 >02_05_1289 - 35470076-35470243,35471032-35471108,35471935-35471971, 35472559-35472618,35472693-35472769,35473244-35473364, 35473505-35473597,35473708-35473770,35475195-35475245, 35475384-35475511,35476249-35476343,35476345-35476427, 35476653-35476808,35477046-35477182,35477243-35477252, 35477291-35477380,35477771-35478070,35479054-35479120, 35479382-35479469,35480317-35480373,35480469-35480592 Length = 693 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 26 SFMRTCTSIPCSARVSTSALNCSL 97 SF R T+ PCSAR ++S+ N SL Sbjct: 594 SFFRFITNFPCSARNNSSSGNSSL 617 >01_06_0138 + 26865895-26865953,26866628-26867870 Length = 433 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 119 PCSVLCGRVSNSRPKLI 69 PCS+ CGR+ N R KL+ Sbjct: 310 PCSLTCGRLLNLREKLV 326 >06_03_0712 + 23803597-23803945,23804118-23805479,23805743-23805811, 23806050-23806330,23806817-23807076,23807521-23807689, 23807796-23808068,23808251-23808499 Length = 1003 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 4 LSEDGEEFFHEDVYVNTVFSKGINFGLELL 93 L E G F HEDV ++ +FS ++ +E L Sbjct: 805 LEEGGTLFTHEDVKMSEIFSSALSVDVESL 834 >06_01_0389 + 2779790-2779891,2780378-2781912,2782087-2782135, 2782620-2782683,2782755-2782843 Length = 612 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 281 GPDTLLADATSLPTLTILSVNSP 213 G D LL+ ATS P LT+L ++ P Sbjct: 115 GDDALLSLATSCPRLTVLRLSEP 137 >05_03_0459 - 14284513-14286336 Length = 607 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 8 PKMAKSSFMRTCTSIPCSARVSTSALNCSLSHRAPNTASH 127 P+ +SS + +S CS S+S N S S R TA H Sbjct: 418 PETPRSSSSDSSSSSSCSGSSSSSERNDSASSRPDTTADH 457 >02_05_0423 - 28834380-28835852,28836987-28837109 Length = 531 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -3 Query: 624 MKVAIVFMGLIALGFSLPQPKKSFVENFR 538 +KVA+V +G +A+G L QP FVE R Sbjct: 476 LKVAVVSLGAVAMGLVL-QPALRFVEKKR 503 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,756,464 Number of Sequences: 37544 Number of extensions: 272538 Number of successful extensions: 957 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 957 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -