BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n22r (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35568| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 29 4.3 SB_57728| Best HMM Match : Usp (HMM E-Value=3.9e-20) 29 4.3 SB_36376| Best HMM Match : DUF360 (HMM E-Value=0.53) 28 5.7 SB_30911| Best HMM Match : TT_ORF2 (HMM E-Value=1.1) 28 5.7 SB_42155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) 28 5.7 SB_33618| Best HMM Match : Guanylate_kin (HMM E-Value=6.3e-13) 28 5.7 SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_19613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_24814| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_17887| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_49861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_43029| Best HMM Match : Extensin_1 (HMM E-Value=8.9) 28 7.6 >SB_35568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 214 GEFTDNIVNVGSEVASAKSVSG--PFNSLTDSFNHFVENINKEMD 342 GEF NI V + A + V P NSL + +ENIN +D Sbjct: 507 GEFISNIFLVPKKTADMRPVINLKPLNSLVQKIHFKMENINVALD 551 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 4/73 (5%) Frame = -3 Query: 576 LPQPKKSFVENFRDFLDIIKDEAGHDIEHLFEHY-IEFEEFQRSFDYL---TTKDFRDLI 409 L + K+ V FRD L+ + ++ G ++ L E Y I F + + SF ++ K DL+ Sbjct: 1292 LVKDKEDMVNGFRDRLNTLANDKGQLVDSLKEEYEILFAQKEDSFMHVRDELEKSQEDLL 1351 Query: 408 YEMEDLPEFKAVV 370 + +L K+ + Sbjct: 1352 HMQVELDSCKSEI 1364 >SB_57728| Best HMM Match : Usp (HMM E-Value=3.9e-20) Length = 744 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -3 Query: 177 AEDEEFRVALENLQSEEWDAVFGALWESEQFKAEVDTLAEHGIDV 43 A+D+EF L+ +EE + + L E QF A+ T A+ + V Sbjct: 252 ADDKEFNETLDMFDAEEGEYIDLVLMEFNQFLADTITRADLSLQV 296 >SB_36376| Best HMM Match : DUF360 (HMM E-Value=0.53) Length = 259 Score = 28.3 bits (60), Expect = 5.7 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 2/86 (2%) Frame = +1 Query: 292 LTDSFNHFVENINKEMDVNVVIFQEID--HSFEFRQVFHLIDQVSEVLRGEVVKRTLELL 465 + D F+ +E + ++ NV++ +D V L+D V+E L +VV + +L Sbjct: 25 MLDVFDDVIEGLIIDVGENVIVGLVLDVVDDVIVGLVLDLVDDVNEGLVLDVVDDVIVVL 84 Query: 466 KFDVMLEQMLDIMTSLVLNYVKEITE 543 FD+ + D++ L+L+ V + E Sbjct: 85 MFDI----VDDVIEGLMLDVVDGVIE 106 >SB_30911| Best HMM Match : TT_ORF2 (HMM E-Value=1.1) Length = 263 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/59 (28%), Positives = 23/59 (38%) Frame = -3 Query: 387 EFKAVVDFLEXXXXXXXXXXXXXNEMIETIGERVKRARHTLSGRDFTSYINDIIGEFPK 211 E KA ++ E IET+ + A H S +D S I I G+F K Sbjct: 45 EAKAQEEYTEANRVVKRSIRADKRSYIETLATEAEEAAHQDSTKDLYSIIKKISGKFAK 103 >SB_42155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 5.7 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 2/86 (2%) Frame = +1 Query: 292 LTDSFNHFVENINKEMDVNVVIFQEID--HSFEFRQVFHLIDQVSEVLRGEVVKRTLELL 465 + D F+ +E + ++ NV++ +D V L+D V+E L +VV + +L Sbjct: 25 MLDVFDDVIEGLIIDVGENVIVGLVLDVVDDVIVGLVLDLVDDVNEGLVLDVVDDVIVVL 84 Query: 466 KFDVMLEQMLDIMTSLVLNYVKEITE 543 FD+ + D++ L+L+ V + E Sbjct: 85 MFDI----VDDVIEGLMLDVVDGVIE 106 >SB_36059| Best HMM Match : TolA (HMM E-Value=0.1) Length = 1936 Score = 28.3 bits (60), Expect = 5.7 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = -3 Query: 189 EQKLAEDEEFRVALENLQSEEWDAVFGALWESEQFKAEVD 70 ++KLAE+EE R LE + EE+DA+ ++ KAEVD Sbjct: 1170 QRKLAEEEEKR-RLEEMSEEEYDAL------TDDQKAEVD 1202 >SB_33618| Best HMM Match : Guanylate_kin (HMM E-Value=6.3e-13) Length = 171 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -3 Query: 492 HLFEHYIEFEEFQRSFDYLTTKDFRDLIYEMEDLPEFKAV 373 H F+H I +F+R+FD + R +I +ED P++ V Sbjct: 133 HYFDHTITNTDFERTFD-----ELRQVIARLEDEPQWVPV 167 >SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/59 (28%), Positives = 23/59 (38%) Frame = -3 Query: 387 EFKAVVDFLEXXXXXXXXXXXXXNEMIETIGERVKRARHTLSGRDFTSYINDIIGEFPK 211 E KA ++ E IET+ + A H S +D S I I G+F K Sbjct: 492 EAKAQEEYTEANRVVKRSIRADKRSYIETLATEAEEAAHQDSTKDLYSIIKKISGKFAK 550 >SB_19613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 Query: 444 QTNAGTPQIRCNARTNARYHDQPRP*LCQGNHGSFLRS 557 +T G P I C+ Y D P LC N GS L++ Sbjct: 6 RTRKGVPNIACSTLPYPVYRDWRGPYLCGRNKGSKLKA 43 >SB_24814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 27.9 bits (59), Expect = 7.6 Identities = 22/99 (22%), Positives = 49/99 (49%), Gaps = 2/99 (2%) Frame = -3 Query: 315 EMIETIGERVK--RARHTLSGRDFTSYINDIIGEFPKDKLAALYEQKLAEDEEFRVALEN 142 E ++T+ + ++ R + L+ S + D + ++ A +QKL E EE + LE Sbjct: 496 EKMQTLQQTMQEEREKDLLNSTHHRSMLEDSLKNTKSEE--ARLKQKLVEAEEEILRLEK 553 Query: 141 LQSEEWDAVFGALWESEQFKAEVDTLAEHGIDVHVLMKE 25 SE D + + ++ + E+D++++ + + L K+ Sbjct: 554 NLSEAQDRLSASEMTRDRLEKELDSMSDLSVRLADLEKQ 592 >SB_17887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -3 Query: 276 RHTLSGRDFTSYINDIIGEFPKDKLAAL--YEQKLAEDEEF 160 RH LSG D T+ + ++ F KD +A + E+ +D +F Sbjct: 60 RHLLSGPDMTNNLLGVLCRFRKDTVALMCDIEKMFFQDNDF 100 >SB_49861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +1 Query: 463 LKFDVMLEQMLDIMTSLVLNYVKEITEVFYEALLRLRQREAKSDQAHKHNSDFHFS 630 LK V+LEQ L +Y KE+ + + L + R + + + + + S+ HF+ Sbjct: 280 LKVVVLLEQGLQACRKRYCDYAKELYKNAADLLSKCRNKSLLTGRTYVYLSEVHFN 335 >SB_43029| Best HMM Match : Extensin_1 (HMM E-Value=8.9) Length = 199 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/48 (33%), Positives = 29/48 (60%) Frame = +1 Query: 478 MLEQMLDIMTSLVLNYVKEITEVFYEALLRLRQREAKSDQAHKHNSDF 621 M++ I SL L++VK+ +VF+E + ++EAKS Q+ +S + Sbjct: 43 MMKLRRRISQSLRLSFVKDDDDVFHEKDSK-TEKEAKSQQSSPRSSSY 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,215,317 Number of Sequences: 59808 Number of extensions: 319636 Number of successful extensions: 1088 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1087 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -