BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n19r (770 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4N768 Cluster: Putative uncharacterized protein; n=2; ... 34 3.4 UniRef50_A5FMU3 Cluster: Putative uncharacterized protein; n=1; ... 34 4.5 UniRef50_Q8IJE8 Cluster: Putative uncharacterized protein; n=1; ... 33 5.9 >UniRef50_Q4N768 Cluster: Putative uncharacterized protein; n=2; Theileria|Rep: Putative uncharacterized protein - Theileria parva Length = 1094 Score = 34.3 bits (75), Expect = 3.4 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -1 Query: 446 VYKLHNKKNLEASTLIPYFCCTIIGSSSENLKMLLHKQTISRLAFSISI--KQFKLFR 279 +YK HN++NL+ T + C ++ S S+ K LL + R I+I K +LF+ Sbjct: 567 MYKCHNERNLKILTFLNNICSKVVESESDFHKSLLRISYLRRSGKQINILNKMCELFK 624 >UniRef50_A5FMU3 Cluster: Putative uncharacterized protein; n=1; Flavobacterium johnsoniae UW101|Rep: Putative uncharacterized protein - Flavobacterium johnsoniae UW101 Length = 119 Score = 33.9 bits (74), Expect = 4.5 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 11/85 (12%) Frame = +2 Query: 353 LSSLKNFQLLC---NKSMVLRLMLLNFFYYGV----YTQIIPKALLIKNGCLETDTVLFI 511 L + N LC N+ ++L LLN Y + + +II LI+ C++T ++FI Sbjct: 35 LELIPNHADLCQKINQVLLLAYYLLNIGYCAMTLISWQKIISSTQLIETICIKTAVIIFI 94 Query: 512 IQYLW*FRLL----HYQPFKHNNKN 574 I L +L + Q HNNKN Sbjct: 95 ISILHYLNILIITKYAQKLIHNNKN 119 >UniRef50_Q8IJE8 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 1309 Score = 33.5 bits (73), Expect = 5.9 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 1/97 (1%) Frame = +2 Query: 365 KNFQLLCNKSMVLRLMLLNFFYYGVYTQIIPKALLIKNGCLETDTVLFIIQYL-W*FRLL 541 ++F ++ NK + +LN+FY+ + + I K +L N L +F+ + W L Sbjct: 314 RHFNIMNNKQA--EIYILNYFYFYIISLIYNKDILTVNFILSIYIDIFVNNLIKWKDIFL 371 Query: 542 HYQPFKHNNKNHYITRLYLIHRALSGSEPYEKGLHFN 652 ++ F + NK I + Y+ + E Y L N Sbjct: 372 FFKTFTNQNKEKCIIQKYINLNNTNFQELYHTELDQN 408 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,990,665 Number of Sequences: 1657284 Number of extensions: 11757617 Number of successful extensions: 22585 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22583 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 64615845515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -