Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV11n19r
         (770 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g48190.1 68416.m05257 ataxia-telangiectasia mutated protein (...    28   5.9  

>At3g48190.1 68416.m05257 ataxia-telangiectasia mutated protein (Atm)
            identical to ataxia-telangiectasia mutated protein (Atm)
            [Arabidopsis thaliana] GI:7529272; contains Pfam profile
            PF00855: PWWP domain; contains GA donor splice site at
            exon 73
          Length = 3255

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 11/63 (17%)
 Frame = +2

Query: 458  KALLIKNGCLETDTVLFIIQY-------LW*FRLL----HYQPFKHNNKNHYITRLYLIH 604
            + L  + GC + D     +QY        W F LL    H QP +H   N+Y   L+   
Sbjct: 2884 RGLTSREGCFQYDPEFIELQYEAAWRAGKWDFSLLYPQTHCQPLQHAKNNNYHESLHCCL 2943

Query: 605  RAL 613
            RAL
Sbjct: 2944 RAL 2946


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,037,214
Number of Sequences: 28952
Number of extensions: 252964
Number of successful extensions: 465
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 456
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 465
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1716774400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)