BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n17f (550 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18810.1 68416.m02389 protein kinase family protein contains ... 33 0.17 At1g21660.1 68414.m02711 expressed protein low similarity to SP|... 31 0.38 At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) iden... 29 1.5 At1g62130.1 68414.m07010 AAA-type ATPase family protein contains... 29 2.0 At3g18660.1 68416.m02370 glycogenin glucosyltransferase (glycoge... 28 3.6 At4g02425.1 68417.m00328 expressed protein 27 6.2 At3g44690.1 68416.m04806 expressed protein 27 6.2 At3g44370.1 68416.m04767 expressed protein weak similarity to At... 27 8.3 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 32.7 bits (71), Expect = 0.17 Identities = 16/69 (23%), Positives = 36/69 (52%) Frame = -2 Query: 408 DNRGGVDGSNDDGLRDNGALFSLFDDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGGN 229 +N G +G+N++ +N + D+NNG D + + N +G+ + ++ + G N Sbjct: 71 NNNDGNNGNNNNDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNN 130 Query: 228 SRSNDNRSG 202 + +N+ +G Sbjct: 131 NDNNNQNNG 139 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -2 Query: 408 DNRGGVDGSNDDGL-RDNGALFSLFDDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGG 232 +N G + N++G +DN + + NN G D +G+N N + + D ++ G G Sbjct: 87 NNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNNN----DNNNQNNGGGS 142 Query: 231 NSRS 220 N+RS Sbjct: 143 NNRS 146 >At1g21660.1 68414.m02711 expressed protein low similarity to SP|O14976 Cyclin G-associated kinase (EC 2.7.1.-) {Homo sapiens}; supporting cDNA gi|20466222|gb|AY099577.1| Length = 523 Score = 31.5 bits (68), Expect = 0.38 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = -2 Query: 360 NGALFSLFDDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGGNSRSNDN 211 NG+LF D + + + +NR S D DV L+K +G NS+S+ N Sbjct: 64 NGSLF----DGDDIFFPANSTNRKVSNDFDVFAGLNKSSSSGDNSKSSLN 109 >At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) identical to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 355 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -2 Query: 336 DDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGGNSRSNDNRSG 202 D NNG +SG SG+ DV ++RRG GG R + G Sbjct: 86 DGNNG----YSGGYTKPSGEGDVSKSSYERRGGGGAPRGSFRGEG 126 >At1g62130.1 68414.m07010 AAA-type ATPase family protein contains Pfam domain, PF00004: ATPase, AAA family Length = 1025 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 58 LIAVASARVFEPISVGPALVDTYEPIDTEPAYVDIPIP 171 ++ V +A+ FE + GPAL+D + +D D IP Sbjct: 375 ILGVMTAKEFESLMNGPALIDRGKSLDLSSGQGDSSIP 412 >At3g18660.1 68416.m02370 glycogenin glucosyltransferase (glycogenin)-related low similarity to glycogenin-1 from Homo sapiens [SP|P46976], Oryctolagus cuniculus [SP|P13280] Length = 655 Score = 28.3 bits (60), Expect = 3.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 111 CRSNGNWFKDTGRSH 67 CR GNW +D GR H Sbjct: 218 CRKEGNWSRDVGRLH 232 >At4g02425.1 68417.m00328 expressed protein Length = 262 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -2 Query: 345 SLFDDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGGNSRSNDNRSG 202 SL DD+NG G S SN + G + +RR + S + +RSG Sbjct: 70 SLADDDNG-GKTLSASNYSNRGSFRLVARKRRRRNSRSVSGRSSDRSG 116 >At3g44690.1 68416.m04806 expressed protein Length = 1176 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -2 Query: 342 LFDDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGGNSRSNDN 211 LFDD + + LD R GDV V+ + + G SND+ Sbjct: 998 LFDDRDQVYLDDERLQRRNGGDVKVYANMRYQDGRQEVYHSNDS 1041 >At3g44370.1 68416.m04767 expressed protein weak similarity to AtOXA1 [Arabidopsis thaliana] GI:6624207 Length = 338 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = -2 Query: 408 DNRGGVDGSNDDGLRDNGALFSLFDDNNGLGLDFSGS 298 D+ GV GSND GL + ++ SL +NG GL+F S Sbjct: 60 DSIAGV-GSNDHGLEFDDSIASL--GSNGHGLEFGDS 93 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,272,434 Number of Sequences: 28952 Number of extensions: 91085 Number of successful extensions: 306 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 299 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -