BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n15r (805 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z67737-3|CAA91538.2| 399|Caenorhabditis elegans Hypothetical pr... 29 5.1 Z75712-7|CAB00046.1| 208|Caenorhabditis elegans Hypothetical pr... 28 9.0 >Z67737-3|CAA91538.2| 399|Caenorhabditis elegans Hypothetical protein T01H10.3 protein. Length = 399 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 402 ILGVSACKLARTSTVPMCQQILLTTSIVLNI 494 ILGV A K+ RT T+P+ ++T +++ I Sbjct: 305 ILGVMADKIPRTGTIPLLGVYIITNLVIMLI 335 >Z75712-7|CAB00046.1| 208|Caenorhabditis elegans Hypothetical protein K04G2.9 protein. Length = 208 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/50 (20%), Positives = 30/50 (60%) Frame = +1 Query: 256 FS*IIFKKTLLISLMTISIYMACFFILVLFEFERVNYINFFRATSLEYIF 405 F I+F +T+L+++ ++++ + F++ F +++++FF + +F Sbjct: 76 FKGILFGQTILLTVASVAMLLTFIFLIAYFFTLHLSHLDFFCWREADLLF 125 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,480,198 Number of Sequences: 27780 Number of extensions: 337025 Number of successful extensions: 773 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1966828226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -