BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n14r (635 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2S676 Cluster: Putative uncharacterized protein; n=1; ... 34 3.3 UniRef50_A1AUH9 Cluster: Putative uncharacterized protein; n=1; ... 34 3.3 >UniRef50_Q2S676 Cluster: Putative uncharacterized protein; n=1; Salinibacter ruber DSM 13855|Rep: Putative uncharacterized protein - Salinibacter ruber (strain DSM 13855) Length = 542 Score = 33.9 bits (74), Expect = 3.3 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 426 LKVGPLGGPSTTLTEEGCSQAWPGLSTTFTPLSDDSQQLLQAPISI 563 L GP GG +T + C W +S TP D+ +++ P++I Sbjct: 385 LVAGPSGGGKSTTIADLCRSGWTHVSDDLTPYDPDTGRVVPLPVTI 430 >UniRef50_A1AUH9 Cluster: Putative uncharacterized protein; n=1; Pelobacter propionicus DSM 2379|Rep: Putative uncharacterized protein - Pelobacter propionicus (strain DSM 2379) Length = 117 Score = 33.9 bits (74), Expect = 3.3 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -2 Query: 550 ACSSCCESSDNGVNVVDNPGQAWEHPSSVNVVDGPPSGPTF 428 A SCC S G+ +D+P + W++PSS ++ P+F Sbjct: 51 ALHSCCASEMRGLFSLDSPSRTWKNPSSRSLSGLTSGAPSF 91 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 567,954,271 Number of Sequences: 1657284 Number of extensions: 10438740 Number of successful extensions: 24380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24376 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47296372782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -