BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n14f (571 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0358 - 17177253-17177369,17177635-17177931,17178961-171790... 29 2.0 09_02_0618 + 11267444-11267652,11268345-11268399,11269554-11270138 28 4.6 03_02_0493 - 8866685-8866888,8866989-8867059,8867143-8867416,886... 27 8.0 >07_03_0358 - 17177253-17177369,17177635-17177931,17178961-17179032, 17179117-17179383,17179752-17179910,17180194-17180295, 17180696-17180767,17181105-17181200,17181710-17181871, 17181941-17182021,17182837-17183094,17183173-17183275, 17183412-17183542,17184827-17184919,17184999-17185099, 17186271-17186355,17186487-17186701,17186779-17186842, 17187128-17187214,17188922-17189022,17190206-17190397, 17190533-17190599,17191211-17191351 Length = 1020 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 428 QIRLYCSDSRSSLAAANKIL*IYPSSCWQL 517 QI+L +D +SSLA+ K+L ++P +C L Sbjct: 321 QIQLKFADYKSSLASFEKVLEVHPENCESL 350 >09_02_0618 + 11267444-11267652,11268345-11268399,11269554-11270138 Length = 282 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -2 Query: 165 GRDYRLRLHHYPTTHNNCCRHPFRYDRVSPYS*IFEMCDCTQLKCTP 25 G+ LHHYP CRHP + ++P+S F + Q+ TP Sbjct: 135 GKRQSTALHHYPP-----CRHPEKVIGIAPHSDGFGLTLLLQVDDTP 176 >03_02_0493 - 8866685-8866888,8866989-8867059,8867143-8867416, 8867666-8868036,8868127-8868482,8868558-8868630, 8869307-8869412,8869667-8869760,8870616-8870680, 8871655-8871927 Length = 628 Score = 27.5 bits (58), Expect = 8.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 490 NLSIVMLATFXQCCYICQASVDSETR 567 ++ +V+LAT+ Q YIC + S TR Sbjct: 457 SIQLVVLATWKQAIYICTSYASSATR 482 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,748,353 Number of Sequences: 37544 Number of extensions: 261231 Number of successful extensions: 570 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1317005676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -