BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n14f (571 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55895| Best HMM Match : ig (HMM E-Value=2.2e-05) 32 0.29 SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 30 1.5 SB_46592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_6257| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_34466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_55895| Best HMM Match : ig (HMM E-Value=2.2e-05) Length = 420 Score = 32.3 bits (70), Expect = 0.29 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 211 GGPSTTLTEEGCSQAWPGLSTTFTPLSDDSQ 119 G + T+T++G SQAW G TF+P+S Q Sbjct: 320 GAINITITKQGSSQAWGGGVVTFSPVSAADQ 350 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 29.9 bits (64), Expect = 1.5 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = -2 Query: 156 YRLRLHHYPTTHNNCCRHPFRYDRVSP 76 +RL +HH+P++ ++ C P ++ + P Sbjct: 391 FRLSIHHHPSSRHHHCHRPLLFNHLRP 417 >SB_46592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 648 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 29 VHFSCVQSHISNIHE*GLTRSYRNGCLQQL 118 V C + ++NIHE G RS+ +GC L Sbjct: 37 VDLFCATTSLNNIHERGYKRSFASGCSAHL 66 >SB_6257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 171 RLGRDYRLRLHHYPTTHNNCCRHPFRYDRVSPYS 70 ++ R + R + + TT N+CC PF+Y+ +S Sbjct: 576 KVSRTDKARCYTWLTTSNDCCVFPFKYNNKQYHS 609 >SB_34466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 120 CESSDNGVNVVDNPGQAWEHPSSVNVVDGPPSG 218 CE NG+ V GQA P+ N D +G Sbjct: 443 CELEGNGIGVSTTRGQAENDPNGTNTTDASTTG 475 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +2 Query: 401 PHRSDVRKQQIRLYCSDSRSSLAAANKIL*IYPSSCWQLLXNAVISVKLPL 553 P+ + +K + CS S SS+ ++ + + CW+ + NA+ SV L L Sbjct: 494 PNLTLYKKHDFAVTCSPSTSSIGPSSLYKFVEGNRCWKTM-NAISSVTLAL 543 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 129 TTHNNCCRHPFRYDRVSPYS 70 T H CC PF Y+ S YS Sbjct: 545 TAHGKCCIFPFVYNATSQYS 564 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,387,636 Number of Sequences: 59808 Number of extensions: 324105 Number of successful extensions: 860 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -