BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n14f (571 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79601-6|CAB01887.1| 872|Caenorhabditis elegans Hypothetical pr... 29 3.1 Z79596-9|CAB01859.1| 872|Caenorhabditis elegans Hypothetical pr... 29 3.1 U49829-6|AAA93387.1| 498|Caenorhabditis elegans Hypothetical pr... 27 7.2 >Z79601-6|CAB01887.1| 872|Caenorhabditis elegans Hypothetical protein K09A9.6 protein. Length = 872 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +3 Query: 45 CNRTFQIFTNKDLHD-HIEMGACSSCCESSDNGVNVVDNPGQAWEHPSSVNVVDGPPS 215 C+ + IF+ KD D H ++ + SS + D+ V ++PG A E + D PP+ Sbjct: 56 CSSLYTIFSAKDAGDSHHDLSSHSS---ADDDDVPAYNHPGSATEDDDDDDDDDEPPT 110 >Z79596-9|CAB01859.1| 872|Caenorhabditis elegans Hypothetical protein K09A9.6 protein. Length = 872 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +3 Query: 45 CNRTFQIFTNKDLHD-HIEMGACSSCCESSDNGVNVVDNPGQAWEHPSSVNVVDGPPS 215 C+ + IF+ KD D H ++ + SS + D+ V ++PG A E + D PP+ Sbjct: 56 CSSLYTIFSAKDAGDSHHDLSSHSS---ADDDDVPAYNHPGSATEDDDDDDDDDEPPT 110 >U49829-6|AAA93387.1| 498|Caenorhabditis elegans Hypothetical protein F27D9.2 protein. Length = 498 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 163 PGLSTTFTPLSDDSQQLLQAPISI*SCKSLFVNI*NV 53 PGL F+PL ++ +L ISI + +LF I NV Sbjct: 188 PGLQLLFSPLGENGINILGLNISIYTSPALFCLILNV 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,221,171 Number of Sequences: 27780 Number of extensions: 247177 Number of successful extensions: 593 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 593 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1187327456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -