BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n11r (553 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0575 + 4601904-4602458 29 1.9 04_01_0382 - 5076673-5077774,5078122-5078186 29 1.9 02_02_0282 - 8540726-8541106 29 1.9 11_01_0591 - 4694710-4695270 29 3.3 11_01_0587 - 4662277-4662837 29 3.3 06_01_0609 + 4404287-4405023,4405496-4405631,4405724-4405876,440... 27 10.0 06_01_0041 + 403634-403817,404154-404332,404431-404536,404620-40... 27 10.0 01_07_0359 - 43042675-43042758,43042956-43043024,43043099-430431... 27 10.0 >11_01_0575 + 4601904-4602458 Length = 184 Score = 29.5 bits (63), Expect = 1.9 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +2 Query: 269 PRTRTALTRLPAGAVYLTLTARELVVAARLTTKLRKSLSLEVILPI-LKALDLSVD-LGS 442 P R A T P +YL A + A + TKL ++ + + P+ L+ SVD L + Sbjct: 50 PEARKATTVGPLAELYLRAIANQTTEAKAMATKLLATMKGKGVPPVCLQQCTASVDTLSN 109 Query: 443 ATSLVDTATIAVNTNNR 493 A + +A+ VN R Sbjct: 110 ALAAFFSASADVNKKYR 126 >04_01_0382 - 5076673-5077774,5078122-5078186 Length = 388 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 Query: 215 KVKPTPPPVRRTLANCVDPRTRTALTRLP 301 K PTPPP RR N +D R + RLP Sbjct: 256 KKLPTPPPKRRLGINMLDGRNKLVEYRLP 284 >02_02_0282 - 8540726-8541106 Length = 126 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 237 GGGVGFTFVNLQFVNAPRRGFSFTVQ 160 GGGV TF+ QFV + GF VQ Sbjct: 12 GGGVKVTFIETQFVTSDAAGFKSLVQ 37 >11_01_0591 - 4694710-4695270 Length = 186 Score = 28.7 bits (61), Expect = 3.3 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 2/77 (2%) Frame = +2 Query: 269 PRTRTALTRLPAGAVYLTLTARELVVAARLTTKLRKSLSLEVILPI-LKALDLSVD-LGS 442 P R A T P +YL A A + TKL ++ + + P+ L+ SVD L + Sbjct: 52 PEARKATTVGPLAELYLQAIANHTTEAKAMATKLLATMKGKGVPPVCLQQCTASVDTLSN 111 Query: 443 ATSLVDTATIAVNTNNR 493 A + +A+ VN R Sbjct: 112 ALAAFFSASADVNKKYR 128 >11_01_0587 - 4662277-4662837 Length = 186 Score = 28.7 bits (61), Expect = 3.3 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 2/77 (2%) Frame = +2 Query: 269 PRTRTALTRLPAGAVYLTLTARELVVAARLTTKLRKSLSLEVILPI-LKALDLSVD-LGS 442 P R A T P +YL A A + TKL ++ + + P+ L+ SVD L + Sbjct: 52 PEARKATTVGPLAELYLQAIANHTTEAKAMATKLLATMKGKGVPPVCLQQCTASVDTLSN 111 Query: 443 ATSLVDTATIAVNTNNR 493 A + +A+ VN R Sbjct: 112 ALAAFFSASADVNKKYR 128 >06_01_0609 + 4404287-4405023,4405496-4405631,4405724-4405876, 4405985-4406128,4406224-4406375,4406453-4406552, 4406653-4406775,4406876-4407037,4407190-4407247, 4407324-4407502,4408294-4408402,4408567-4408637, 4408891-4408986,4409727-4409803,4410983-4411066, 4411473-4411607,4411744-4411819,4413072-4413167, 4413580-4413671,4413745-4413868,4413966-4414052 Length = 996 Score = 27.1 bits (57), Expect = 10.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 212 TKVKPTPPPVRRTLANCVDPRTRT 283 T VKPTP P R+ A P+T T Sbjct: 78 TPVKPTPTPKRKRAAPSPSPKTPT 101 >06_01_0041 + 403634-403817,404154-404332,404431-404536,404620-404936, 405231-405605,406199-406283,406570-408066,408575-408738 Length = 968 Score = 27.1 bits (57), Expect = 10.0 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -2 Query: 435 RSTDRSNALSIG-SITSSDRLLRSFVVSRAATTNSRAVNVRYTAP 304 +STD + S G I SSDR S V S + VN TAP Sbjct: 557 KSTDNKGSSSFGLHIGSSDRSHNSDVTSNGGVSGIAPVNKAETAP 601 >01_07_0359 - 43042675-43042758,43042956-43043024,43043099-43043159, 43043260-43043768,43044545-43045153,43045697-43045972, 43046581-43046769,43047006-43047116,43047621-43047908, 43047990-43048041,43048648-43048824,43049249-43049314, 43049675-43049929,43050071-43050577,43050807-43050886, 43050974-43051207 Length = 1188 Score = 27.1 bits (57), Expect = 10.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 209 FTKVKPTPPPVRRTLANCVDPRTRTALTRLPAGA 310 F+ + P P+RR +A+C+ P T P A Sbjct: 32 FSSARKPPEPLRRAVADCLSPPAPHTHTHAPPPA 65 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,330,058 Number of Sequences: 37544 Number of extensions: 224112 Number of successful extensions: 656 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -