BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n09f (543 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0376 - 22474473-22476947 30 1.4 06_03_0025 - 15577231-15577420,15577682-15577813,15578025-155781... 28 4.2 02_01_0369 + 2649178-2655291,2655773-2656601,2656737-2657425,265... 28 4.2 03_01_0594 - 4385291-4385503,4385647-4385829,4385944-4386117,438... 28 5.5 01_05_0282 - 20347915-20348874,20348968-20349012,20349568-203498... 28 5.5 05_03_0155 - 9002049-9002134,9002825-9004139 27 9.7 03_06_0662 + 35377974-35378270,35378354-35378623,35378795-353789... 27 9.7 >02_04_0376 - 22474473-22476947 Length = 824 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = +2 Query: 422 SSFKEYMCPLA*ASS--SSVGETLRKEVQLPTITYTV 526 SSF E++C + + S +GE L+K+V+ T+ YT+ Sbjct: 482 SSFIEHLCKMKGSQEGLSFIGEMLQKDVKPSTVNYTI 518 >06_03_0025 - 15577231-15577420,15577682-15577813,15578025-15578173, 15579012-15579071,15593208-15593297,15593604-15593871, 15594517-15594608,15595355-15595441,15597333-15597440, 15597709-15597822,15598253-15598420,15599442-15599579, 15599699-15599908,15600986-15601237,15601965-15602111, 15603327-15603443 Length = 773 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Frame = +1 Query: 154 NVWIQQCAGAVLTNFHILSVATC------FSGAFYRPDTRRIRLGSDIRNEGGLIVNVL 312 N++ ++ +L L A C F GAFY PD+ +I + + +GG + NV+ Sbjct: 168 NIFEKEKRQQILNEMRTLCEACCYIGLVEFQGAFYMPDSGQISIALEYM-DGGSLANVI 225 >02_01_0369 + 2649178-2655291,2655773-2656601,2656737-2657425, 2657523-2657649,2657731-2657812,2658172-2658196 Length = 2621 Score = 28.3 bits (60), Expect = 4.2 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -1 Query: 267 ETNTTSIGPVEGSRETSGNRQDMEVGEYGTSTLLDPNVAQGD-FNLSQTGA 118 + + + PV+ + GN QD+ V E+G+ ++P G+ + TGA Sbjct: 120 DVDNADVLPVQEGGDGGGNAQDVGVSEHGSLEHVNPGPGDGEGATIPVTGA 170 >03_01_0594 - 4385291-4385503,4385647-4385829,4385944-4386117, 4386213-4386373,4386470-4386551,4386626-4386658, 4386755-4387161,4387237-4387381,4387483-4387587, 4387704-4387826,4387908-4388027,4388118-4388237, 4388569-4388775,4388857-4389036,4389151-4389285, 4389382-4389519,4389630-4389728,4389832-4389951, 4390029-4390091 Length = 935 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 174 TLLDPNVAQGDFNLSQTGAVTDRHSSAKVVG*DAASCCEQ 55 T+L +A G +LSQ GA+T R ++ + + CC++ Sbjct: 298 TVLSVTLAIGSHHLSQQGAITKRMTAIEEMAGMDVLCCDK 337 >01_05_0282 - 20347915-20348874,20348968-20349012,20349568-20349816, 20350393-20350581,20351051-20351155,20351165-20351488, 20351493-20351555 Length = 644 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 427 LQGVHVPPRLSVELIGWGNTPQGGAVTDD 513 L+G H RL L+GW N PQ V +D Sbjct: 55 LEGYHGITRLKWHLVGWQNRPQCLNVPED 83 >05_03_0155 - 9002049-9002134,9002825-9004139 Length = 466 Score = 27.1 bits (57), Expect = 9.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 106 PISDRPSLAQVEVALGNVW 162 P SDRP L VE+ G+VW Sbjct: 279 PFSDRPELHFVELPRGSVW 297 >03_06_0662 + 35377974-35378270,35378354-35378623,35378795-35378973, 35380073-35380116,35380295-35380384,35380472-35380588, 35380679-35380803,35380883-35381155,35381253-35381386, 35381518-35381604,35381714-35381831 Length = 577 Score = 27.1 bits (57), Expect = 9.7 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +1 Query: 280 RNE-GGLIVNVLLANNHHSFDPTNMASDISVV 372 RN+ GGLI ++ +HH+ + + + DISV+ Sbjct: 156 RNKYGGLITKSVMVGSHHNSNRSEVCHDISVM 187 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,434,186 Number of Sequences: 37544 Number of extensions: 382453 Number of successful extensions: 958 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1210221432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -