BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n06r (748 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 0.57 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 25 1.00 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 23 4.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 4.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 4.0 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.3 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 25.4 bits (53), Expect = 0.57 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 98 LPTHFGXRQGHPSQYYRSHGHHP 166 LP + Q HPSQY+ G P Sbjct: 312 LPPSYHPHQHHPSQYHPHRGSSP 334 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 24.6 bits (51), Expect = 1.00 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = +2 Query: 50 YGGRRHWNCSFQKTQCLPTHFGXRQGHPSQYYRSHGHHPG 169 + +W C+ +KT T G +GH R G + G Sbjct: 60 FNDENYWQCNDKKTDIEETGRGKGRGHGKGGSRGRGGNRG 99 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 361 WIIAPCWIFGPKWMACVTRTMLTSL 435 W+I PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 361 WIIAPCWIFGPKWMACVTRTMLTSL 435 W+I PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 361 WIIAPCWIFGPKWMACVTRTMLTSL 435 W+I PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -2 Query: 414 SNTCHPLRPKYPAGCYYPTRCRNTPGYF 331 S++C + Y T CR PGYF Sbjct: 276 SHSCEACPAHSKSSDYGFTECRCDPGYF 303 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 237,576 Number of Sequences: 438 Number of extensions: 6120 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -