BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n05f (604 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 2.0 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 23 2.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.1 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -2 Query: 153 VHAAIFVP*VGLITLITAVLTRVAIVANV 67 VH I V +G + ++ ++ +AI+AN+ Sbjct: 404 VHRKIMVQSLGRVGVLVVIIGTLAIIANL 432 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -2 Query: 153 VHAAIFVP*VGLITLITAVLTRVAIVANV 67 VH I V +G + ++ ++ +AI+AN+ Sbjct: 129 VHRKIMVQSLGRVGVLVVIIGTLAIIANL 157 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.1 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +2 Query: 404 NMDLHYIRPNGVDLRSFDDQVPEDTRTFDHVNFNQN 511 N +HY G D R +P ++F + NQN Sbjct: 2045 NFTIHYWIEKGADRRKLVMGMPMYGQSFSLADNNQN 2080 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,933 Number of Sequences: 336 Number of extensions: 3014 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -