BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n05f (604 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0840 + 28570642-28570809,28570919-28571025,28571137-285712... 31 0.70 06_03_1497 + 30585074-30586327 30 1.6 07_01_0564 - 4183441-4183530,4183683-4183752,4183972-4184063,418... 29 2.1 01_06_1273 + 35896320-35896400,35896548-35896736,35897817-358979... 29 2.1 08_01_0083 - 604175-605776 29 2.8 04_04_1397 - 33230416-33230742,33230852-33231007,33231130-332315... 28 5.0 10_01_0232 + 2456449-2456652,2456814-2456897,2459113-2459201,245... 28 6.5 06_03_0608 + 22705321-22705652,22705809-22706178,22706264-227066... 28 6.5 08_01_0089 - 646310-646397,646566-647932 27 8.7 >04_04_0840 + 28570642-28570809,28570919-28571025,28571137-28571238, 28571786-28571981,28572691-28572819,28572869-28572895, 28572896-28573090,28573182-28573292 Length = 344 Score = 31.1 bits (67), Expect = 0.70 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 296 DDNSKVIIVEGPVAAGKTAFAASLADDLGMKHFPEANMDLHYIRPNGVDL 445 D N +I+ GP GKT SLA +L + EA ++L+ G+D+ Sbjct: 47 DGNMPNLILSGPPGTGKTTSILSLAHELLGPSYREAVLELNASDDRGLDV 96 >06_03_1497 + 30585074-30586327 Length = 417 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 305 SKVIIVEGPVAAGKTAFAASLADDL 379 +KVI++ GP AGKT A LA L Sbjct: 25 NKVIVISGPTGAGKTRLALDLAKRL 49 >07_01_0564 - 4183441-4183530,4183683-4183752,4183972-4184063, 4184141-4184240,4184372-4184478,4184703-4184768, 4184879-4185013,4185653-4185808,4186113-4186262, 4186426-4186557,4187604-4187693 Length = 395 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 308 KVIIVEGPVAAGKTAFAASLADDLGMK 388 + +++ GP A GKTA A ++ +LG K Sbjct: 4 RALLLAGPPATGKTALALGISQELGSK 30 >01_06_1273 + 35896320-35896400,35896548-35896736,35897817-35897948, 35898093-35898242,35898564-35898719,35899462-35899596, 35899706-35899771,35900016-35900122,35900258-35900357, 35900436-35900527,35901026-35901095,35901229-35901318 Length = 455 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 308 KVIIVEGPVAAGKTAFAASLADDLGMK 388 + +++ GP A GKTA A ++ +LG K Sbjct: 64 RALLLAGPPATGKTALALGISQELGSK 90 >08_01_0083 - 604175-605776 Length = 533 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +2 Query: 230 FDYVNKDYTWLRSLIDRTTHRFDDNSKVIIVEGPVAAGKTAFAASLA 370 FD + D+ W R + R+ + KV + EGP AG + LA Sbjct: 410 FDVLGNDFGWGRPVSVRSGGANKFDGKVTVYEGPDGAGSMSLEVCLA 456 >04_04_1397 - 33230416-33230742,33230852-33231007,33231130-33231543, 33234177-33234307,33235076-33235202,33235709-33236209, 33237624-33237935,33238690-33238719 Length = 665 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -2 Query: 531 AAKRWLGF*LKLTWSKVLVSSGTWSSKDLKSTPFGR-I*CKSMLASGKCFIPKSSAREAA 355 A KR +K W+K + G W+ + K+T GR +++LAS + + + S R+ A Sbjct: 60 AGKRVTKKQVKWRWAKSRKNFGMWTWLESKATGLGRDTVSQAILASDEWWEIQESERKGA 119 Query: 354 KA 349 KA Sbjct: 120 KA 121 >10_01_0232 + 2456449-2456652,2456814-2456897,2459113-2459201, 2459245-2459452,2459764-2459883,2460004-2460087, 2460171-2460242,2460342-2460455,2460852-2460952, 2461024-2461117,2461265-2461432,2461539-2461616, 2461908-2461973,2462052-2462108,2462353-2462572, 2462867-2463003,2465379-2465450,2465530-2465577, 2465681-2465806,2465982-2466047,2466508-2466620, 2467348-2467432,2467885-2467980,2468067-2468114, 2468190-2468258,2468393-2468581 Length = 935 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 413 LHYIRPNGVDLRSFDDQVP--EDTRTFDHVNFNQNPNHRLAA 532 +HY P+G FDD VP +D FD+ N + N +AA Sbjct: 243 VHYSPPDGFGFEIFDDFVPVQDDMLLFDY-NLKERVNDFVAA 283 >06_03_0608 + 22705321-22705652,22705809-22706178,22706264-22706656, 22707183-22707204,22707257-22707928,22708019-22708494 Length = 754 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 419 YIRPNGVDLRSFDDQVPEDTRTFDH 493 YIRP + RS ++ +D RTF H Sbjct: 493 YIRPKDPNFRSVHKRIRDDRRTFPH 517 >08_01_0089 - 646310-646397,646566-647932 Length = 484 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +2 Query: 230 FDYVNKDYTWLRSLIDRTTHRFDDNSKVIIVEGPVAAGKTAFAASLA 370 FD D+ W R R+ + KV + EGP AG + LA Sbjct: 390 FDVFGNDFGWGRPASVRSGGANKFDGKVTVYEGPGGAGSMSLEVCLA 436 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,644,991 Number of Sequences: 37544 Number of extensions: 310435 Number of successful extensions: 792 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -