BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n02r (447 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78198-7|CAB01573.1| 622|Caenorhabditis elegans Hypothetical pr... 69 2e-12 >Z78198-7|CAB01573.1| 622|Caenorhabditis elegans Hypothetical protein F55C5.8 protein. Length = 622 Score = 68.5 bits (160), Expect = 2e-12 Identities = 27/72 (37%), Positives = 49/72 (68%) Frame = -2 Query: 410 KKVRPQDLTRLYEIILQNYNELQQLPGFENDAVYQKEIDTQMKAYRAFRCYYIAQVLTGL 231 KK +PQDL RLY+ +++ Y E+ ++PG ++D + + +++ YRAFRC+Y+A + L Sbjct: 371 KKSKPQDLLRLYDSVIEIYKEVAEIPGADHDKNLIQAFEVKVEYYRAFRCFYMASSYSAL 430 Query: 230 RRFREALAMLER 195 ++ EA A+ +R Sbjct: 431 HKYSEAAALFDR 442 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,956,546 Number of Sequences: 27780 Number of extensions: 137416 Number of successful extensions: 354 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 354 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 777938954 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -