BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11n02r (447 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 27 0.12 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 24 0.87 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 24 0.87 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 24 0.87 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 1.2 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 1.2 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 4.6 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 4.6 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 26.6 bits (56), Expect = 0.12 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 392 DLTRLYEIILQNYNELQQLPGFENDAVYQK 303 D RLY+ +L NYN L + ND V K Sbjct: 20 DAKRLYDDLLSNYNRLIRPVSNNNDTVVVK 49 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.8 bits (49), Expect = 0.87 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 392 DLTRLYEIILQNYNEL 345 D RLY+ +L NYN+L Sbjct: 28 DAKRLYDDLLSNYNKL 43 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.8 bits (49), Expect = 0.87 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 392 DLTRLYEIILQNYNEL 345 D RLY+ +L NYN+L Sbjct: 28 DAKRLYDDLLSNYNKL 43 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.8 bits (49), Expect = 0.87 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 392 DLTRLYEIILQNYNEL 345 D RLY+ +L NYN+L Sbjct: 24 DAKRLYDDLLSNYNKL 39 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.4 bits (48), Expect = 1.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 383 RLYEIILQNYNELQQLPGFENDAVYQK 303 RLY+ +L NYN L + G +D + K Sbjct: 23 RLYDDLLSNYNRLIRPVGNNSDRLTVK 49 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 Query: 392 DLTRLYEIILQNYNEL 345 D RLY+ +L NYN L Sbjct: 33 DTKRLYDDLLSNYNRL 48 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.4 bits (43), Expect = 4.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 293 YRFPFDKLRRSQSPATVAVHCNSAE 367 YRFP ++ + S T+AV E Sbjct: 166 YRFPQNQFKESSLFVTIAVDVRDTE 190 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 4.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 153 QSTTKGQVASLEEGH 109 +ST G+VASL E H Sbjct: 497 ESTCSGEVASLTEYH 511 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,620 Number of Sequences: 438 Number of extensions: 1550 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11697255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -