BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m19r (779 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51467| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 2e-25 SB_40642| Best HMM Match : Sod_Fe_N (HMM E-Value=3.8e-10) 95 6e-20 SB_23784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_14229| Best HMM Match : VAR1 (HMM E-Value=5) 29 4.2 SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) 29 5.6 SB_55823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 >SB_51467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 465 Score = 113 bits (272), Expect = 2e-25 Identities = 65/211 (30%), Positives = 109/211 (51%), Gaps = 17/211 (8%) Frame = -2 Query: 706 QKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDI--DTI 533 +K+TLPELPY+YN LEP I + +HH HHA Y LN A ++ ++ + D+ +I Sbjct: 245 EKYTLPELPYDYNELEPHIDEATLRVHHLGHHAAYTKKLNAALKEWRESGKEKDLASKSI 304 Query: 532 INLA-----------PALKFNGGGHINHSIFWHNLSPNGGK----PSDVLTKAVEKDFGS 398 + + + NGGG +NH+++W +SPN P+ + ++K G+ Sbjct: 305 VEILRNNEQIPDKWRTDVINNGGGFVNHALYWATMSPNPKSEPRTPTGKIGDLIDKSHGN 364 Query: 397 WDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEH 218 + K ++ GSG+ WL + L I NQ+ A L P+ ID+WEH Sbjct: 365 FSMFKQWFDEQVNSMFGSGYTWLCQDVTSGFLTILNMGNQESPVAYR-LNPVLVIDLWEH 423 Query: 217 AYYLQYKNVRADYVKAIFDVANWNDISQRYE 125 A+YL+++N R YV + + + +W +++ E Sbjct: 424 AFYLKHQNKRPGYVHSWWHLVDWERVNELLE 454 >SB_40642| Best HMM Match : Sod_Fe_N (HMM E-Value=3.8e-10) Length = 75 Score = 95.1 bits (226), Expect = 6e-20 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -2 Query: 709 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK 551 R KHTLP+LPY+Y+ALEP I+ EIM LHHSKHHATY+NNLN+AEEK +AQAK Sbjct: 22 RAKHTLPDLPYDYDALEPTINTEIMRLHHSKHHATYVNNLNIAEEKCLEAQAK 74 >SB_23784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 202 TEDSTRAPIHRFRRAGPIQWWPAE 273 T+D + P+ RFR GPIQ P E Sbjct: 36 TDDDFKPPLKRFRTPGPIQRIPGE 59 >SB_14229| Best HMM Match : VAR1 (HMM E-Value=5) Length = 356 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 536 HYQPCTSLEIQWWWSHQPLDLLAQPVT 456 HY ++ WW SH PLD A+ T Sbjct: 18 HYSNHREAQVGWWLSHWPLDTAARART 44 >SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) Length = 4607 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 221 ARVLSSVQERSCRLRESYFRCSQLE*YISEI 129 ARV S V++R L S F CS +E Y+ +I Sbjct: 3054 ARVCSVVEQRIPALLNSSFLCSHIEDYVDDI 3084 >SB_55823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 27.9 bits (59), Expect = 9.8 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = -2 Query: 607 TYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVL 428 T NLN+A + Q I T++ + P L +GGG N I + GK DVL Sbjct: 24 TMHENLNIAFQTQETHQL---IYTVLEVQPRLASSGGGKTNDEIVYELADSILGKLMDVL 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,996,473 Number of Sequences: 59808 Number of extensions: 537538 Number of successful extensions: 1801 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1798 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -