BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m19r (779 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismuta... 264 2e-72 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 27 0.86 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 25 3.5 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 6.1 AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase pr... 24 6.1 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 8.0 >AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismutase 1 protein. Length = 206 Score = 264 bits (648), Expect = 2e-72 Identities = 117/174 (67%), Positives = 135/174 (77%) Frame = -2 Query: 709 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 530 R KHTLP+LPY++ ALEPVI REIM LHH KHH Y+ NLN AEE+L A AK D+ II Sbjct: 31 RSKHTLPDLPYDFGALEPVICREIMELHHQKHHNAYVTNLNAAEEQLQDAVAKQDVSKII 90 Query: 529 NLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNLKNQLSTASVAVQ 350 L A+KFNGGGHINHSIFW NLSP+ PS L KA+ +DF + +N K ++ A+VAVQ Sbjct: 91 QLGNAIKFNGGGHINHSIFWKNLSPDRSDPSAELQKALNRDFQNMENFKKEMKAAAVAVQ 150 Query: 349 GSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYLQYKNVR 188 GSGW WLGYNK+ K LQIA C NQDPL+ATTGLVPL GIDVW HAYYLQYKN+R Sbjct: 151 GSGWAWLGYNKKTKLLQIAACPNQDPLEATTGLVPLLGIDVWXHAYYLQYKNLR 204 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 26.6 bits (56), Expect = 0.86 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -2 Query: 628 HHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGG 494 HH +HHA ++ + + + GD + + +A AL GGG Sbjct: 723 HHHQHHAAPHHHSLQQQHASSAFNSAGDARSGVAVAAALNTGGGG 767 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 24.6 bits (51), Expect = 3.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 260 GGLQRILVLACSYLQFLHLFVVAKPTPA*ALYCHRS 367 G L+ + C Y Q +HL + AK P A+Y + S Sbjct: 20 GKLRLYSMRFCPYAQRVHLMLDAKKIPYHAIYINLS 55 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 724 VAGASRQKHTLPELPYEYNALEPV 653 +AG +R HT+ +L EY P+ Sbjct: 65 IAGIARVYHTIKQLKSEYKTKNPL 88 >AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase protein. Length = 98 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 724 VAGASRQKHTLPELPYEYNALEPV 653 +AG +R HT+ +L EY P+ Sbjct: 65 IAGIARVYHTIKQLKSEYKTKNPL 88 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 23.4 bits (48), Expect = 8.0 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = -3 Query: 558 KLKVISTPLSTLHQP*NSMVVVTSTTRSFGTTCHQMVASLL 436 K+ ++ PL+ + Q ++ + +T T + CH + A L Sbjct: 161 KISLVVYPLAMIAQTASAYLTLTVTLERYVAVCHPLRARAL 201 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 810,478 Number of Sequences: 2352 Number of extensions: 17492 Number of successful extensions: 35 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -