BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m19f (595 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismuta... 192 1e-50 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 27 0.60 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 4.3 AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase pr... 24 4.3 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 5.6 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 7.4 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 9.8 >AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismutase 1 protein. Length = 206 Score = 192 bits (467), Expect = 1e-50 Identities = 84/134 (62%), Positives = 100/134 (74%) Frame = +3 Query: 192 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 371 R KHTLP+LPY++ ALEPVI REIM LHH KHH Y+ NLN AEE+L A AK D+ II Sbjct: 31 RSKHTLPDLPYDFGALEPVICREIMELHHQKHHNAYVTNLNAAEEQLQDAVAKQDVSKII 90 Query: 372 NLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNLKNQLSTASVAVQ 551 L A+KFNGGGHINHSIFW NLSP+ PS L KA+ +DF + +N K ++ A+VAVQ Sbjct: 91 QLGNAIKFNGGGHINHSIFWKNLSPDRSDPSAELQKALNRDFQNMENFKKEMKAAAVAVQ 150 Query: 552 GSGWGWLGYNKQMK 593 GSGW WLGYNK+ K Sbjct: 151 GSGWAWLGYNKKTK 164 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 26.6 bits (56), Expect = 0.60 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +3 Query: 273 HHSKHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPALKFNGGG 407 HH +HHA ++ + + + GD + + +A AL GGG Sbjct: 723 HHHQHHAAPHHHSLQQQHASSAFNSAGDARSGVAVAAALNTGGGG 767 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 177 VAGASRQKHTLPELPYEYNALEPV 248 +AG +R HT+ +L EY P+ Sbjct: 65 IAGIARVYHTIKQLKSEYKTKNPL 88 >AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase protein. Length = 98 Score = 23.8 bits (49), Expect = 4.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 177 VAGASRQKHTLPELPYEYNALEPV 248 +AG +R HT+ +L EY P+ Sbjct: 65 IAGIARVYHTIKQLKSEYKTKNPL 88 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 23.4 bits (48), Expect = 5.6 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +1 Query: 343 KLKVISTPLSTLHQP*NSMVVVTSTTRSFGTTCHQMVASLL 465 K+ ++ PL+ + Q ++ + +T T + CH + A L Sbjct: 161 KISLVVYPLAMIAQTASAYLTLTVTLERYVAVCHPLRARAL 201 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 526 CRQLLWQYRAQAGVGLATT 582 CR+LLW + VG TT Sbjct: 839 CRELLWLQKLMKDVGEKTT 857 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.6 bits (46), Expect = 9.8 Identities = 11/40 (27%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 155 KDWIIDSSC---RCFSPEAYFARASVRVQCTGAGH*P*NH 265 + W C RC + + +S R QC G P H Sbjct: 204 QSWASPDGCIVYRCVKENGFLSISSSRKQCPAVGDCPDQH 243 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,652 Number of Sequences: 2352 Number of extensions: 12704 Number of successful extensions: 22 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -