BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m19f (595 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 25 0.42 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 25 0.42 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 25 0.42 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 22 3.9 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 3.9 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 9.1 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.1 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.1 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 25.4 bits (53), Expect = 0.42 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 450 HLVTGCAKRSSG*CDHH 400 H VTGC +R+ G C H+ Sbjct: 128 HPVTGCGERTEGRCLHY 144 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 25.4 bits (53), Expect = 0.42 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 450 HLVTGCAKRSSG*CDHH 400 H VTGC +R+ G C H+ Sbjct: 133 HPVTGCGERTEGRCLHY 149 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 25.4 bits (53), Expect = 0.42 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 450 HLVTGCAKRSSG*CDHH 400 H VTGC +R+ G C H+ Sbjct: 133 HPVTGCGERTEGRCLHY 149 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = +3 Query: 453 GKPSDVL---TKAVEKDFGSWDNL 515 GK +V+ TKA+ SWDN+ Sbjct: 136 GKTDEVVFRQTKAIANKINSWDNV 159 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 3.9 Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 213 ELPYEYNALEP---VISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTI 368 +LP E P ++ I L HH+T I N + + K DTI Sbjct: 291 DLPPETQPTPPSATLVGTTITHLRDPDHHSTDIQNCDSVKIKFETLHTMDSSDTI 345 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = +3 Query: 372 NLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKD 494 N+AP L GG + W +PS +T KD Sbjct: 79 NIAPYLNQIYGGQFVRDLIWTPTVYVSNEPSSAITGNNVKD 119 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 530 DSFCGSTGLRLGLAWLQQ 583 D +CG +R GL+WL++ Sbjct: 685 DLYCG---IRAGLSWLER 699 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 530 DSFCGSTGLRLGLAWLQQ 583 D +CG +R GL+WL++ Sbjct: 723 DLYCG---IRAGLSWLER 737 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,269 Number of Sequences: 438 Number of extensions: 3486 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -