BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m15f (583 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 1.4 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 24 3.1 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 25.4 bits (53), Expect = 1.4 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = -1 Query: 508 GTPPMLSHL--YLEPSF*TPQQPELYLCQKTVEQ--LSTLQRRSRHRHPSLGRGKGSCKK 341 GTPP L + + + + QQ + Q++++Q LS Q++ R R PS +G S ++ Sbjct: 220 GTPPSPEQLQNHQQTAQQSSQQQQQQQQQQSLQQQQLSQQQQQQRQRQPSSQQGDSSSQR 279 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.2 bits (50), Expect = 3.1 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 Query: 271 TQEEWLSLWDKYAQTSTPQEW 333 T E+W WD A TS W Sbjct: 873 TIEQWQQQWDAEADTSRHTRW 893 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,299 Number of Sequences: 2352 Number of extensions: 10494 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -