BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m11f (508 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomy... 29 0.53 SPAC18G6.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 28 0.70 SPCPB16A4.05c |||urease accessory protein UREG |Schizosaccharomy... 27 1.2 >SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1201 Score = 28.7 bits (61), Expect = 0.53 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +1 Query: 136 NFDHDKHIFTGHGGKQRTKKEASEH--TNHFDPSGHSRKIVTKLMNAEHNKKTSNTKH 303 N + D + H K ++ S H +HFDPS + +K+V+ + K +S KH Sbjct: 18 NEEDDDYYSNAHSEKS---EDHSNHIKVSHFDPSSYKQKLVSVRETQRNRKFSSLQKH 72 >SPAC18G6.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 312 Score = 28.3 bits (60), Expect = 0.70 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +1 Query: 160 FTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHN 279 ++GH ++ NHF+ +GH +T +N+ +N Sbjct: 242 YSGHNSPHTNYSASTPSFNHFNAAGHPTGNITPTLNSPNN 281 >SPCPB16A4.05c |||urease accessory protein UREG |Schizosaccharomyces pombe|chr 3|||Manual Length = 286 Score = 27.5 bits (58), Expect = 1.2 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +1 Query: 121 EYDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHS 240 +YD++N DH H H + EA+ GHS Sbjct: 21 DYDHHNHDHHGHDHHSHDSSSNSSSEAA-RLQFIQEHGHS 59 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,034,248 Number of Sequences: 5004 Number of extensions: 37908 Number of successful extensions: 98 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -