BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m07f (507 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93383-11|CAI58635.1| 279|Caenorhabditis elegans Hypothetical p... 28 3.4 >Z93383-11|CAI58635.1| 279|Caenorhabditis elegans Hypothetical protein F54B8.16 protein. Length = 279 Score = 28.3 bits (60), Expect = 3.4 Identities = 19/74 (25%), Positives = 32/74 (43%) Frame = -3 Query: 391 VFALLHELIEDGFLLFCRLARALPTAPLRPHRTACHFDCFLVRFYEK*NLELCTLYVTMS 212 + +L ++ D F++FC + PL C F+ RF+E + + +L MS Sbjct: 129 IIPILGHILFDHFIMFCFCGN-VREVPLDCDNFQCTFNKCYQRFWETRDQVVFSLIEIMS 187 Query: 211 YYIVIELYCTKLKS 170 + LY K S Sbjct: 188 VLFFVRLYIWKRTS 201 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,453,140 Number of Sequences: 27780 Number of extensions: 154476 Number of successful extensions: 375 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -