BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m06r (729 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061092-1|AAL28640.1| 380|Drosophila melanogaster LD07994p pro... 29 6.5 AE013599-725|AAF59034.1| 380|Drosophila melanogaster CG8269-PA ... 29 6.5 >AY061092-1|AAL28640.1| 380|Drosophila melanogaster LD07994p protein. Length = 380 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +2 Query: 497 KQTSEATKTSVSTVRCIINEAKGSGLLAVLRTPGKKRSGKKKVTGMDSFVQ 649 KQ+ +A T +ST R ++ K +L +TPG K+ K ++ ++ F Q Sbjct: 131 KQSYDAVATVISTARKVLESLKLEQVLGKEQTPGSKQV-KALISQVEEFKQ 180 >AE013599-725|AAF59034.1| 380|Drosophila melanogaster CG8269-PA protein. Length = 380 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +2 Query: 497 KQTSEATKTSVSTVRCIINEAKGSGLLAVLRTPGKKRSGKKKVTGMDSFVQ 649 KQ+ +A T +ST R ++ K +L +TPG K+ K ++ ++ F Q Sbjct: 131 KQSYDAVATVISTARKVLESLKLEQVLGKEQTPGSKQV-KALISQVEEFKQ 180 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,501,793 Number of Sequences: 53049 Number of extensions: 652646 Number of successful extensions: 1660 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1658 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3273062859 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -