BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m01f (599 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_23845| Best HMM Match : IL6 (HMM E-Value=1.2) 29 2.2 SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) 29 3.8 SB_19929| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_3027| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_32459| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_4460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 685 Score = 32.7 bits (71), Expect = 0.23 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 4/89 (4%) Frame = +3 Query: 90 MAETMKQTVASILKSIERYNPANLEILERYVEMQSRENTYDLGANLAVLKLYQFNPEKFN 269 ++ T Q V I ++ +NL +LE Y E + + Y LG N + +L + N Sbjct: 294 ISSTTNQGVWFIDSGATKHMTSNLNVLEHYTEYKEPKKIY-LGDNTVIFELDEGNAHLTT 352 Query: 270 ADITC----QILLKALTNFPHTDFTLCKC 344 D +C Q +++A N +FTL C Sbjct: 353 CDRSCVRATQSVIRAQVN---KEFTLEAC 378 >SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 141 RYNPANLEILERYVEMQ 191 RYNP NL++LE YV +Q Sbjct: 682 RYNPENLKVLEHYVHLQ 698 >SB_23845| Best HMM Match : IL6 (HMM E-Value=1.2) Length = 1388 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -2 Query: 394 YLI*EIVSFSTTDSRSKHLHNVKSVCGKLVR 302 YL+ + SF TT R+ H+H +KS+ L+R Sbjct: 1358 YLLNSLHSFLTTIHRAIHVHKIKSLLNFLIR 1388 >SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) Length = 972 Score = 28.7 bits (61), Expect = 3.8 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 119 CYCLFHSFGHCICH*CYY 66 CYC ++ + +C C+ CYY Sbjct: 482 CYCYYYCYYYCYCY-CYY 498 >SB_19929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -2 Query: 370 FSTTDSRSKHLHNVKSVCGKLVR 302 FS + +KHL N +VCGK ++ Sbjct: 180 FSIIEKAAKHLDNTTNVCGKCIQ 202 >SB_3027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 886 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = -1 Query: 566 QICQVVFVNSLKCDTNHMTDKLSD*VMEATDTTAQLWH 453 ++C F K N + ++S+ T+ A++WH Sbjct: 713 RLCSFAFSKQTKTRKNRVATRISELTSSGTEGVAEIWH 750 >SB_32459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2011 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 6/49 (12%) Frame = +1 Query: 412 SNVTLLSFGIEYTK------CQSCAVVSVASMTQSESLSVMWLVSHFRL 540 S VT+ SF Y K C+ C V V T S ++ V W ++H+ L Sbjct: 1356 SRVTVHSFQSSYVKTALGVLCKICKVCLVVISTLSLAVYVRWSMAHYAL 1404 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,086,998 Number of Sequences: 59808 Number of extensions: 362273 Number of successful extensions: 765 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 764 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -