BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11m01f (599 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/n... 25 1.4 AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleo... 25 1.4 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 25 1.9 AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding pr... 24 4.3 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 23 7.5 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 7.5 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 7.5 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 7.5 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 7.5 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 7.5 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 7.5 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 7.5 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 7.5 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 7.5 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 7.5 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 7.5 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 7.5 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 10.0 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 10.0 AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. 23 10.0 >AJ441131-4|CAD29633.1| 566|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 566 Score = 25.4 bits (53), Expect = 1.4 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 Query: 409 WSNVTLLSFGIEYTKCQSCAVVSVASMTQSESLSVMW 519 W+ LL FGI T C V A+ Q +S W Sbjct: 2 WTVPALLRFGICLTVTAVCGVCCAAASEQGVLISKTW 38 >AJ439398-3|CAD28126.1| 566|Anopheles gambiae putative 5' nucleotidase protein. Length = 566 Score = 25.4 bits (53), Expect = 1.4 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +1 Query: 409 WSNVTLLSFGIEYTKCQSCAVVSVASMTQSESLSVMW 519 W+ LL FGI T C V A+ Q +S W Sbjct: 2 WTVPALLRFGICLTVTAVCGVCCAAASEQGVLISKTW 38 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 25.0 bits (52), Expect = 1.9 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A T+ +T+A +I+KS+E + PAN E Sbjct: 60 APTIVKTIAQPTIIKSVEHHAPANYE 85 >AY146740-1|AAO12100.1| 139|Anopheles gambiae odorant-binding protein AgamOBP9 protein. Length = 139 Score = 23.8 bits (49), Expect = 4.3 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 2/86 (2%) Frame = +3 Query: 309 NFPHTDFTLC--KCLLLESVVENETISQIKYLADILEQCDFAQFWNRVHQMPELCSRISG 482 NFP D T C KC+ + + ++T I + +++ Q + N V + C+ + Sbjct: 52 NFPEDDTTQCYIKCIFNKMQLFDDTNGPI--VDNLVVQLAHGRDANEVREEIVKCAGSNT 109 Query: 483 FHDSIRKFVCHVVGITFQTIDKNNLA 560 + VCH FQ KNNL+ Sbjct: 110 DGN-----VCHWAFRGFQCFQKNNLS 130 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.0 bits (47), Expect = 7.5 Identities = 21/85 (24%), Positives = 38/85 (44%) Frame = +3 Query: 81 TDTMAETMKQTVASILKSIERYNPANLEILERYVEMQSRENTYDLGANLAVLKLYQFNPE 260 ++T + TM + + K+ + EI ER VE E TYD+ N+ Q+ Sbjct: 313 SETSSTTMNFCLYELAKNPDIQGRLREEI-ERAVEENGGEVTYDMVMNV------QYLDS 365 Query: 261 KFNADITCQILLKALTNFPHTDFTL 335 N + +++L+ P D+T+ Sbjct: 366 VINETLRKYPPIESLSRVPMRDYTV 390 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 68 APAIVKTIAQPTIIKSVEHHAPANYE 93 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 60 APAIVKTIAQPTIIKSVEHHAPANYE 85 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 60 APAIVKTIAQPTIIKSVEHHAPANYE 85 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 68 APAIVKTIAQPTIIKSVEHHAPANYE 93 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 60 APAIVKTIAQPTIIKSVEHHAPANYE 85 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 68 APAIVKTIAQPTIIKSVEHHAPANYE 93 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 92 APAIVKTIAQPTIIKSVEHHAPANYE 117 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 60 APAIVKTIAQPTIIKSVEHHAPANYE 85 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 68 APAIVKTIAQPTIIKSVEHHAPANYE 93 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 60 APAIVKTIAQPTIIKSVEHHAPANYE 85 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 68 APAIVKTIAQPTIIKSVEHHAPANYE 93 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 7.5 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +3 Query: 93 AETMKQTVA--SILKSIERYNPANLE 164 A + +T+A +I+KS+E + PAN E Sbjct: 60 APAIVKTIAQPTIIKSVEHHAPANYE 85 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +3 Query: 480 GFHDSIRKFVCHVVGITFQTIDKNNLANLLGGID 581 G H+++RKF +G + + + L GG D Sbjct: 257 GAHEAVRKFEYTFLGTVTEFMFSHYLGRAFGGND 290 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 22.6 bits (46), Expect = 10.0 Identities = 6/21 (28%), Positives = 14/21 (66%) Frame = +1 Query: 319 IPILHCASAYFLNPWWKMRQF 381 IP+ C++AY P++++ + Sbjct: 120 IPLAECSNAYSAGPYFQLTSY 140 >AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. Length = 128 Score = 22.6 bits (46), Expect = 10.0 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -2 Query: 226 KLAPKSYVFSRDCISTYR 173 KL+P +YV +C+ ++R Sbjct: 45 KLSPTAYVTDAECVRSHR 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 621,213 Number of Sequences: 2352 Number of extensions: 11947 Number of successful extensions: 30 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -