BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l24r (759 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 24 1.3 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 24 1.3 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 24 1.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 7.2 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 9.5 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 634 RLQGFVFTVIVDEVAFCGVPVAIEHVLASGEVIYGPV 744 RL + + DEV G PV I + SGEV+ G + Sbjct: 488 RLALDMMDLAADEVQIDGEPVKITIGIHSGEVVTGVI 524 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 634 RLQGFVFTVIVDEVAFCGVPVAIEHVLASGEVIYGPV 744 RL + + DEV G PV I + SGEV+ G + Sbjct: 488 RLALDMMDLAADEVQIDGEPVKITIGIHSGEVVTGVI 524 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.8 bits (49), Expect = 1.8 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = -1 Query: 438 KGSLTTPPYTECVTWIIYEKPVQIGSEQLGLLRQLEGPD---SQPIERNV 298 K + T T+C W I + Q + GL RQ E D S PI +N+ Sbjct: 175 KRTATITAATDCQLWAIDRQCFQTIMMRTGLSRQAEYTDFLKSVPIFKNL 224 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 725 SPDASTCSMATGTPQNATSSTITVNTN 645 S STCS+A QN T + N N Sbjct: 513 STATSTCSLAVAKQQNQVPLTSSSNVN 539 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 7.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 471 EDLQIGNYVTYKGSLTT 421 E LQ+G YVT G + + Sbjct: 438 ERLQVGQYVTVNGDVVS 454 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/23 (34%), Positives = 10/23 (43%) Frame = +3 Query: 402 HTRCRAVSSGSPCKSRSCRFEGL 470 H RC + P R+C GL Sbjct: 153 HPRCAVNNYNDPSNVRNCELVGL 175 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,432 Number of Sequences: 438 Number of extensions: 5573 Number of successful extensions: 25 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -