BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l23f (568 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 218 3e-57 SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 176 1e-44 SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) 36 0.030 SB_33690| Best HMM Match : Fer4 (HMM E-Value=2.1) 32 0.38 SB_3221| Best HMM Match : rve (HMM E-Value=3) 29 2.0 SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) 28 4.6 SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) 28 4.6 SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) 27 8.1 SB_47788| Best HMM Match : Cir_Bir_Yir (HMM E-Value=8.6) 27 8.1 SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 27 8.1 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 218 bits (532), Expect = 3e-57 Identities = 97/116 (83%), Positives = 109/116 (93%) Frame = +3 Query: 51 KPRGIRTARKHVNHRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQP 230 KPRG+RTARK +HRR+Q+W DK +KKAH+GT KANPFGGASHAKGIVLEKVGVEAKQP Sbjct: 2 KPRGLRTARKLRSHRRDQKWHDKAYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQP 61 Query: 231 NSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGV 398 NSAIRKCVRVQLIKNGKK+TAFVP DGCLN+IEENDEVL++GFGR+GHAVGDIPG+ Sbjct: 62 NSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLISGFGRRGHAVGDIPGI 117 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 176 bits (428), Expect = 1e-44 Identities = 81/91 (89%), Positives = 89/91 (97%) Frame = +3 Query: 201 EKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAV 380 ++ GVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN+IEENDEVL++GFGR+GHAV Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLISGFGRRGHAV 112 Query: 381 GDIPGVRFKVVKVANVSLLALYKEKKERPRS 473 GDIPGVRFKVVKVANVSLLAL+KEKKERPRS Sbjct: 113 GDIPGVRFKVVKVANVSLLALFKEKKERPRS 143 >SB_54786| Best HMM Match : Ribosomal_S12 (HMM E-Value=1.4e-12) Length = 302 Score = 35.5 bits (78), Expect = 0.030 Identities = 16/39 (41%), Positives = 27/39 (69%) Frame = +3 Query: 186 KGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVP 302 KG+ ++ + K+PNSA RKC ++L NGK ++A++P Sbjct: 230 KGVCVKVFIRKPKKPNSAQRKCALLKL-SNGKTISAYIP 267 >SB_33690| Best HMM Match : Fer4 (HMM E-Value=2.1) Length = 488 Score = 31.9 bits (69), Expect = 0.38 Identities = 25/79 (31%), Positives = 31/79 (39%), Gaps = 5/79 (6%) Frame = -1 Query: 268 MSCTRTHLRMAELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHR 104 M C + E+ C PT R T DA P GL H M L+ + R Sbjct: 58 MPCQLDYPNYREMPCQLDCPTTERCPANWTTQLQRDALPTGLPKHR-EMPCQLDYPTTER 116 Query: 103 CSRRWFTCLRAVRIPRGLP 47 C W T L+ +P GLP Sbjct: 117 CPANWTTQLQRDALPTGLP 135 Score = 29.1 bits (62), Expect = 2.6 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = -1 Query: 235 ELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHRCSRRWFTCLRA 71 E+ C PT R T DA P GL ++ M L+ + RC W T L+ Sbjct: 139 EMPCQLDYPTTERCPANWTTQLQRDALPTGLP-NYREMSCQLDYPTTERCPANWTTQLQR 197 Query: 70 VRIPRGLP 47 +P GLP Sbjct: 198 DTLPTGLP 205 Score = 28.7 bits (61), Expect = 3.5 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 5/68 (7%) Frame = -1 Query: 235 ELGCLASTPTFSR-----TMPFA*DAPPKGLAFHFVPMWAFLNSLSAHRCSRRWFTCLRA 71 E+ C PT R T DA P GL ++ M L+ + RC W T L+ Sbjct: 104 EMPCQLDYPTTERCPANWTTQLQRDALPTGLP-NYREMPCQLDYPTTERCPANWTTQLQR 162 Query: 70 VRIPRGLP 47 +P GLP Sbjct: 163 DALPTGLP 170 >SB_3221| Best HMM Match : rve (HMM E-Value=3) Length = 324 Score = 29.5 bits (63), Expect = 2.0 Identities = 23/70 (32%), Positives = 34/70 (48%) Frame = -1 Query: 496 SLITMYTYDLGRSFFSL*RARRDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFSSMWF 317 S T TYDL SF+S+ + + LAT +K++P + + L+P A S S Sbjct: 9 SFDTFPTYDLA-SFYSVLCSGDEQLATIKLMKKSPSLFQKSHTLKPR-ANCASIASETLA 66 Query: 316 RQPSRGTNAV 287 +Q R N V Sbjct: 67 QQCWRSLNTV 76 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 131 SPHGYEMEG*PFRWCISRKGHRPRESWCRS*AA 229 S HG MEG P W +S G P+ S C S +A Sbjct: 85 SQHGTRMEGVPVCWYVSVWGLSPQVSQCDSVSA 117 >SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) Length = 943 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -1 Query: 199 RTMPFA*D-APPKGLAFHFVPMW-AFLN-SLSAHR 104 R +PF+ APPKG F VP+W +F N S+ HR Sbjct: 902 RKVPFSSVLAPPKGYRFLIVPLWRSFSNRSVFGHR 936 >SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) Length = 471 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -3 Query: 311 TVTGDECGHFLSVLNELYTDAFADGRVGLLSFYTNFLED 195 T D+ F NE AD R GL+ NF+ED Sbjct: 159 TTDPDKLNRFFVTTNERTLGTKADDRSGLIELVNNFVED 197 >SB_32242| Best HMM Match : Pam16 (HMM E-Value=7.4e-20) Length = 255 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 91 TVVNSDGRTKNSRKPTWVRNGRLTLSVVHLT 183 T V R N++KP +R+GR+T+S+ +T Sbjct: 103 THVQFHHRDTNTKKPVHLRDGRVTVSLAAMT 133 >SB_47788| Best HMM Match : Cir_Bir_Yir (HMM E-Value=8.6) Length = 294 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -3 Query: 299 DECGHFLSVLNELYTDAFADGRVGLLSFYTNFLED 195 D+ F NE AD R GL+ NF+ED Sbjct: 114 DKLNRFFVTTNERTLGTKADDRSGLIELVNNFVED 148 >SB_33607| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 256 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 123 ILCPPIAVHDGGSRAYAPFV 64 ++ PP + DG SRA+APF+ Sbjct: 215 LIKPPSTIVDGRSRAHAPFI 234 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,621,686 Number of Sequences: 59808 Number of extensions: 448381 Number of successful extensions: 963 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -