BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l22f (621 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 29 0.12 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 3.4 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 23 5.9 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 23 5.9 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 5.9 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 5.9 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 5.9 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 7.8 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 7.8 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 29.1 bits (62), Expect = 0.12 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 392 YNLQLRFRAYSHCRTWSRWTHRWY 463 Y+L+ RAY H T+ RW W+ Sbjct: 1000 YDLEPELRAYLHTNTYVRWGDPWF 1023 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 3.4 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +3 Query: 558 DDANIVEVLH-TTAGLIGYDY 617 DDANI ++LH TT GL Y + Sbjct: 239 DDANINDLLHFTTKGLTMYRF 259 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 23.4 bits (48), Expect = 5.9 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 431 DNANKLGIVAEGCSQDIDEFSN*STALTSVGQTLGV*FRSRTPVDGDYVYI 279 D+ + LG + + +DE + A+TSVG V ++ VD +++I Sbjct: 331 DHKSMLGALKQSTFVQVDENGTEAAAVTSVGTKFRV-RNTQFRVDRPFIFI 380 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 23.4 bits (48), Expect = 5.9 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = +3 Query: 522 HGWTHNPEILNPDDANIVEVLHTTAGLIGY 611 + W + P+ L P+D +V ++ G++G+ Sbjct: 131 NSWIYGPDNLMPEDV-VVVTINYRLGILGF 159 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 5.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 200 DGAASEGERRSHNR 159 DGA SEG R SH++ Sbjct: 1028 DGAPSEGRRLSHSK 1041 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.4 bits (48), Expect = 5.9 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 471 RNSNQPIPHIIALDPSLH 524 RNS +P+ H++ L+ L+ Sbjct: 175 RNSTEPVEHVLHLEEELY 192 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.4 bits (48), Expect = 5.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 522 HGWTHNPEILNPDDANIVEVLHTT 593 HG H P+ P+ +I+EV T Sbjct: 230 HGAQHRPQTTRPNRQDIIEVTSFT 253 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.0 bits (47), Expect = 7.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 516 SLHGWTHNPEILNPDDANIVEVLHTTAGLIGYD 614 +LH +HNPE + I E++ G I Y+ Sbjct: 311 TLHELSHNPEAMAKLQQEIDEMMERYNGEITYE 343 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.0 bits (47), Expect = 7.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 516 SLHGWTHNPEILNPDDANIVEVLHTTAGLIGYD 614 +LH +HNPE + I E++ G I Y+ Sbjct: 311 TLHELSHNPEAMAKLQQEIDEMMERYNGEITYE 343 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,025 Number of Sequences: 2352 Number of extensions: 11961 Number of successful extensions: 34 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -