BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11l22f (621 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03140.1 68415.m00267 CAAX amino terminal protease family pro... 38 0.005 At4g05260.1 68417.m00795 ubiquitin family protein contains INTER... 30 1.1 At1g02610.1 68414.m00211 zinc finger (C3HC4-type RING finger) fa... 29 2.5 At2g28870.1 68415.m03509 expressed protein 29 3.3 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 28 4.3 At1g54430.1 68414.m06209 hypothetical protein 28 5.7 At4g02075.1 68417.m00278 zinc finger (C3HC4-type RING finger) fa... 27 7.6 >At2g03140.1 68415.m00267 CAAX amino terminal protease family protein very low similarity to SP|Q40863 Late embryogenesis abundant protein EMB8 from Picea glauca; contains Pfam profile PF02517 CAAX amino terminal protease family protein Length = 1805 Score = 37.9 bits (84), Expect = 0.005 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 1/113 (0%) Frame = -2 Query: 473 SSCDTSDVSTETKSDNANKLGIVAEGCSQDIDEFSN*STALTSVGQTLGV*FRSRTPVDG 294 S+ D S++++E KSD+AN+ I AE + + D+ S T GQ S+ G Sbjct: 758 SAADDSEMASEAKSDSANQGPIGAEAVTNNDDKVEQGSGVATHQGQVE----TSKNDEKG 813 Query: 293 DYVYIFSGEVS-GYDESVEVSSDSFTVIVYREDGAASEGERRSHNRVDRQQQR 138 + V+ G++++ + +DS D S+G++ V QQQR Sbjct: 814 APIANEKSSVADGFEKASDAKNDSTNPQPVGADDITSDGDKVDQGVVLAQQQR 866 >At4g05260.1 68417.m00795 ubiquitin family protein contains INTERPRO:IPR000626 ubiquitin domain Length = 259 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -2 Query: 305 PVDGDYVYIFSGEVSGYDESVEVSSDSFTVIV 210 P DGDY ++ G V D+S E +S + T IV Sbjct: 219 PQDGDYFFVHKGRVLNEDQSFEWNSVAHTDIV 250 >At1g02610.1 68414.m00211 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 146 Score = 29.1 bits (62), Expect = 2.5 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 222 HRDCVS*RWCGERGRT 175 HRDC+ RWC E+G T Sbjct: 46 HRDCIQ-RWCDEKGNT 60 >At2g28870.1 68415.m03509 expressed protein Length = 156 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 478 EFLAAIPAMCPPRPSPTMRISSES*LKV 395 + L+A+P +CPP P R+ S S LKV Sbjct: 93 QILSAMPRICPPAPRKPKRVPSRS-LKV 119 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 28.3 bits (60), Expect = 4.3 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +3 Query: 138 PLLLSVNSIMTSSFSLARRTIFTIHNHGETVAGNFNAFVIP 260 PL+L+ NSI S +AR ++FT N G ++ NF+ +P Sbjct: 34 PLVLAPNSI---SSLIARNSLFTASNIGPSIDFNFSNTSLP 71 >At1g54430.1 68414.m06209 hypothetical protein Length = 1639 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = +3 Query: 66 YSFNLGERDVVFHLFHRGSPQVSE--PLLLSV 155 +S N+GERDV+ H G Q+S+ PL +++ Sbjct: 491 FSKNIGERDVIVHHKSSGLQQISDLHPLFMTL 522 >At4g02075.1 68417.m00278 zinc finger (C3HC4-type RING finger) family protein contains InterPro Entry IPR001841 Zn-finger, RING Length = 218 Score = 27.5 bits (58), Expect = 7.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 222 HRDCVS*RWCGERGRT 175 HR+C+ RWC E+G T Sbjct: 46 HRNCIQ-RWCNEKGNT 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,422,845 Number of Sequences: 28952 Number of extensions: 242347 Number of successful extensions: 695 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -